KEGG   Collimonas fungivorans: CFU_0072Help
Entry
CFU_0072          CDS       T01583                                 

Definition
(GenBank) Putative cytoplasmic protein USSDB7A
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
cfu  Collimonas fungivorans
Pathway
cfu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cfu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CFU_0072
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cfu02044]
    CFU_0072
Secretion system [BR:cfu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CFU_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AEK59911
UniProt: G0A800
Position
complement(107278..107769)
Genome map
AA seq 163 aa AA seqDB search
MAIDVYLQIDGIKGESTDSAHKDWIECKSVQWEVLQPKSATASTGGGHTAERCEHKDIVV
TKIADLATPLLLQNCSSGKTIPKAKFEFLRADGKGDRIKYFEIELVNLLISDVTPSVQEG
DVLSESISLKYSQVKWKYTQQKIGGGSGGNTSGGWDLSTNKVV
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgacgtttatctgcaaatcgacggcatcaagggcgagtcgaccgacagtgcg
cacaaggactggatcgagtgcaaatcggtgcaatgggaagtgctgcagccaaagtcggcg
actgcatccaccggcggcggccacacagccgagcgttgcgaacacaaggacatcgtcgtg
accaagatcgccgatctggctacgccgctgctgctgcagaactgctcatcgggtaagacc
atcccgaaagccaagttcgaattcctgcgcgccgacggcaagggcgaccgcatcaagtat
ttcgaaatcgagctggtcaacctgctgatttccgacgtcacgccatcggtccaggaaggc
gacgtgctgagcgaaagcatcagcctgaagtactcccaggtcaaatggaagtacacacag
caaaaaatcggcggcggttcgggcggcaatacttccggcggctgggatctgtcgaccaac
aaggtcgtgtaa

DBGET integrated database retrieval system