KEGG   Collimonas fungivorans: CFU_0074
Entry
CFU_0074          CDS       T01583                                 

Gene name
impB
Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
cfu  Collimonas fungivorans
Brite
KEGG Orthology (KO) [BR:cfu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cfu02044]
    CFU_0074 (impB)
Secretion system [BR:cfu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CFU_0074 (impB)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AEK59913
UniProt: G0A802
Position
complement(109282..109791)
AA seq 169 aa
MAKKESTQKRLQKVRPPRVQMTYDVEIGDAIEQKELPFVMGVIGDFSGKSEVAQTKLKDR
KFVNIDNDNFDEVMKGVEPRAAFRVPNHLSDAGGEFGVDLKFKSIDDFRPEAVVQQIEPL
KQLLEARTKLADLRNKLAGNDKLEDILNDVLNSTEKLAALSKQTKKQGD
NT seq 510 nt   +upstreamnt  +downstreamnt
atggctaaaaaagagagtactcaaaaacgtttgcagaaagtccgtccaccacgggtgcaa
atgacatacgacgttgaaatcggcgacgccatcgagcaaaaggaattgccgttcgtgatg
ggcgtgatcggcgatttcagcggcaagtccgaagtggcccagaccaagctgaaggaccgc
aagttcgtcaatatcgacaacgacaacttcgatgaagtgatgaagggcgtcgagccgaga
gctgcgttccgcgtgccgaatcatttgagcgacgccggcggcgagttcggggtcgacttg
aagttcaagtcgatcgacgatttccgcccggaagcggtagtccagcagatcgagccgctc
aagcagctgctcgaagcccgcaccaaactggccgacctgcgcaacaagctggccggcaac
gacaagctggaagatatcctcaacgatgtgctcaacagcaccgaaaagctggcggcgtta
agcaagcaaaccaagaagcaaggagactga

DBGET integrated database retrieval system