KEGG   Collimonas fungivorans: CFU_0489Help
Entry
CFU_0489          CDS       T01583                                 

Gene name
bktB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00071  Fatty acid degradation
cfu00072  Synthesis and degradation of ketone bodies
cfu00280  Valine, leucine and isoleucine degradation
cfu00310  Lysine degradation
cfu00362  Benzoate degradation
cfu00380  Tryptophan metabolism
cfu00620  Pyruvate metabolism
cfu00630  Glyoxylate and dicarboxylate metabolism
cfu00640  Propanoate metabolism
cfu00650  Butanoate metabolism
cfu00900  Terpenoid backbone biosynthesis
cfu01100  Metabolic pathways
cfu01110  Biosynthesis of secondary metabolites
cfu01120  Microbial metabolism in diverse environments
cfu01130  Biosynthesis of antibiotics
cfu01200  Carbon metabolism
cfu01212  Fatty acid metabolism
cfu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFU_0489 (bktB)
   00630 Glyoxylate and dicarboxylate metabolism
    CFU_0489 (bktB)
   00640 Propanoate metabolism
    CFU_0489 (bktB)
   00650 Butanoate metabolism
    CFU_0489 (bktB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFU_0489 (bktB)
   00072 Synthesis and degradation of ketone bodies
    CFU_0489 (bktB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFU_0489 (bktB)
   00310 Lysine degradation
    CFU_0489 (bktB)
   00380 Tryptophan metabolism
    CFU_0489 (bktB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFU_0489 (bktB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFU_0489 (bktB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFU_0489 (bktB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfu04147]
    CFU_0489 (bktB)
Enzymes [BR:cfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CFU_0489 (bktB)
Exosome [BR:cfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFU_0489 (bktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEK60326
UniProt: G0AHP8
Position
589428..590672
Genome map
AA seq 414 aa AA seqDB search
MARQQALPSHRQTNKEINMANTREVVIVGAARTAIGAYGGALKDLAPGELGAVAVKEAFA
RAGVDPLQAGQIIFGNVIHTEARDMYVSRVVGLNAGMGKESTALTLNRLCGSGLQAIITA
ANAIQLDETDVAVGGGVESMSRSLYGSQAARWGARMGDIKMVDMMIGALSDPFGGGHMGI
TAENVAEKYSISREEQDAFALESQKRATAAIAAGYFKSQIVPVEIKTRKGVVSFDTDEYP
KADATLESLAKLKPAFKKEGGTVTAGNASGINDGAAACVLMEAGAAVRAGRTPLARLVSY
GVAGVDPSIMGTGPIPAVQLALKRAGLSLQDMAVIESNEAFAAQSLGVCKGLGLDPKLTN
VNGGAIALGHPLGASGTIIAVKCLYELIRTNKRYGLITMCIGGGQGIALIIERI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaggcagcaagcattgccgtcgcatcgtcaaaccaacaaggagataaacatggct
aatacaagagaagttgtcatcgtcggcgctgcccgtaccgctatcggcgcatatggcggc
gcgttgaaggacctggcgccgggcgagctcggcgcggtggcggtgaaggaagcctttgcg
cgcgccggcgtcgatccgctgcaagccggccagatcatattcggcaacgtcatccacacc
gaggcgcgcgacatgtatgtatcgcgcgtggtgggcctgaatgccggcatgggcaaggaa
tccacggcgctgaccctgaaccggctatgcggctcgggtctgcaagcgatcatcacggct
gccaacgccatccagctggacgagaccgatgtcgcggtcggcggcggcgtcgaaagcatg
agccgctcgctgtatggatcacaagccgcgcgctggggcgcgcgcatgggcgacatcaag
atggtcgacatgatgatcggcgcgctgtccgatcctttcggcggcggccatatggggatc
actgctgaaaacgtggcggagaaatacagcatttcgcgtgaagagcaggatgccttcgcg
ctggaaagccagaaacgcgccaccgcggccatcgctgccggctacttcaagtcgcagatc
gtgccggttgaaatcaagacacgcaaaggcgttgtatcgttcgataccgatgaatatccg
aaagctgacgccaccctggagtcgctggccaagctgaagccggcgttcaagaaagaaggc
ggcacggtcactgccggcaatgcttccggcatcaacgacggcgccgcggcttgcgtcctg
atggaagcaggggctgcagtccgcgccgggcgcacgccgctggcgcgcctggtttcctat
ggggtggcgggggtcgatccgtcgatcatgggcaccggtccgatcccggcagtccagctg
gccttgaagcgcgccggcctgagcctgcaggacatggcggtgattgaatcgaacgaagcg
ttcgctgcgcagtcgctgggcgtatgcaaagggctgggcctggatcccaagctgaccaat
gtcaatggcggcgcaatcgcgctgggccatccgttgggcgcgagcgggacgatcattgcg
gtcaagtgcctgtacgaactgattcgtactaacaagcgctatggcttgatcaccatgtgc
attggcggcggccaaggcattgcgctgatcatcgagcgcatctga

DBGET integrated database retrieval system