KEGG   Collimonas fungivorans: CFU_0515Help
Entry
CFU_0515          CDS       T01583                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00340  Histidine metabolism
cfu01100  Metabolic pathways
cfu01110  Biosynthesis of secondary metabolites
cfu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CFU_0515 (hisD)
Enzymes [BR:cfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CFU_0515 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh 2_5_RNA_ligase2
Motif
Other DBs
NCBI-ProteinID: AEK60352
UniProt: G0AHS4
Position
618997..620364
Genome map
AA seq 455 aa AA seqDB search
MKKLRFNKTQQTGSNMIAIRKLDAGLPDFQAHLTALLAFEASEDEAIDQAAARILADVKA
RGDAAVLEYTNRFDRLSANSVSLLEIGQQELQAALAELSPERRGALQTAADRVRSYHQRQ
KIECGSDGFSYTEADGTVLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAKVAGVQEII
MVVPTPDGVKNPLVLAAAAIAGVDRVFTIGGAQAVAALAYGTATIPQVDKIVGPGNAYVA
AAKRRVFGTVGIDMIAGPSEILVICDGTTDPDWIAMDLFSQAEHDELAQSILLCPDAAYI
AAVEASINRQLPLMPRQEVIRTSLVNRGALVKVRDMEHACEIANHIAAEHLEISAENPQH
WADRIRHAGAMFLGRFSSEALGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSIINISE
AGAQTLGQVAAELAYGEGLQAHARSAEYRLKDKPQ
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagcttcgattcaataagacgcagcaaactggaagcaacatgatagcaatcaga
aaactcgatgcaggactgccggatttccaggcgcacctgactgcgctgctggctttcgag
gccagcgaagacgaagccatcgaccaggctgccgcgcgcatcctggctgacgtcaaggcg
cgcggcgacgccgccgtgctggaatacaccaaccgtttcgaccgcctcagcgccaacagc
gtcagcctgctcgaaattggccagcaggaactgcaggcggcgctggctgaactgtctccc
gaacgccgcggcgccttgcagactgcggccgaccgcgtgcgcagctaccaccagcgccag
aaaatcgaatgcggttcggacggcttcagttacaccgaagccgacggcaccgtgctgggg
cagaaagtcacgccgctggaccgcgtcggcatctatgtccccggcggcaaggcggcttat
ccttcgtcggtgctgatgaatgcgatcccggccaaggtcgccggcgtgcaggaaatcatc
atggtggtgccgactccggacggcgtcaagaatccgctggtgctggccgccgcggctatc
gccggcgtcgaccgcgtgtttaccatcggcggcgcgcaagcggtggcggcgctggcctac
ggcactgccaccattccccaggtcgacaagattgtcggtcccggcaacgcctatgtcgcg
gcggccaaacggcgcgtgttcggcacggtcggcatcgacatgatcgccgggccctcggaa
atcctggtgatctgcgacggcactaccgatcccgactggatcgcgatggatctgttttcg
caagccgagcacgatgaactggcgcaatcgatcctgctgtgtccggacgcggcgtatatt
gccgccgtcgaagccagcatcaaccgccagctgccgctgatgccgcgccaggaagtgatc
cgcacctcgttggtcaaccgcggcgcgctggtgaaagtgcgcgacatggagcatgcctgc
gagatcgccaaccacattgccgccgagcacctggaaatttccgctgaaaatccgcagcac
tgggccgaccgcatccgccatgccggcgccatgttcctcggccggttttcgtcggaagcc
ttgggcgattactgcgccggtccgaaccacgtgctgccgacttcgcgcaccgcgcgtttt
tcgtcgccgctcggcgtctacgatttccagaaacgctccagcatcatcaacatcagcgag
gccggcgcccagaccctgggccaggtcgcggcggaactggcgtacggcgaaggcttgcag
gcgcatgcccggtccgccgaataccgcttgaaagacaagccgcaatga

DBGET integrated database retrieval system