KEGG   Collimonas fungivorans: CFU_0705Help
Entry
CFU_0705          CDS       T01583                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
cfu  Collimonas fungivorans
Brite
KEGG Orthology (KO) [BR:cfu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CFU_0705 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AEK60539
UniProt: G0AF12
Position
825457..825831
Genome map
AA seq 124 aa AA seqDB search
MAAYEFTVSVKTQYLEEQSQPDSSHYVFAYAITIKNTGQVAAQLISRHWVITDANNHVEE
VRGLGVVGHQPLLQPGEQFEYTSGTSMATPQGSMTGEYFCVAEDGEQFEARIPEFILSLP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctatgaatttaccgtttctgtcaaaacgcagtacctggaagagcagtcccag
cctgacagttcgcactatgtattcgcctatgcgatcacgatcaagaacaccgggcaggtc
gcggcccagctgatttcacgccactgggtgatcaccgacgccaacaatcatgtcgaggaa
gtacgcggcctgggcgtggtcggccaccagcccctgctgcagccgggcgagcagttcgaa
tacaccagcggcacttcgatggcgacgccgcagggttcgatgacgggcgagtatttctgc
gtggcggaagacggcgagcagttcgaggcgcgcattccggaattcatcctgtccctgccg
cgcaccctgcattga

DBGET integrated database retrieval system