KEGG   Collimonas fungivorans: CFU_1083Help
Entry
CFU_1083          CDS       T01583                                 

Gene name
jamB3
Definition
(GenBank) Delta-9 fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
cfu  Collimonas fungivorans
Pathway
cfu01040  Biosynthesis of unsaturated fatty acids
cfu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CFU_1083 (jamB3)
Enzymes [BR:cfu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CFU_1083 (jamB3)
Lipid biosynthesis proteins [BR:cfu01004]
 Desaturase
  First
   CFU_1083 (jamB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AEK60915
UniProt: G0AIY2
Position
complement(1264925..1265872)
Genome map
AA seq 315 aa AA seqDB search
MIDTKNPAAAAPGEKVQALRDGDSKARRLAYLTVLTPAVGFVAALWYSIQFGFKQQDMIL
FGVMYFLTSFGVEGGLHRFFSHRAFKAGPVVTAVIGILGCMAAQGPILFWAATHRMHHVF
TDQDGDPHSPRVLSPGLRGRIKALWHGHVGWLFTVKRSNWSTYVPDLFGSKLVLFVNQHY
LIWVFLGLALPAAAGAALSGVEGAVGGLLWGGLARIFLLDQVTWAVNSIGHTFGKRPNQT
RDTSGNIGWLALVSAGGGWHNNHHANPALAHNDFHFWQIDTTAWVIRLLGLLGLAWDIRQ
RQSADPLDQKLFNND
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgataccaaaaatcccgctgccgcagcgcctggcgagaaagtgcaagcgctcagg
gatggcgatagcaaggctcgccggctggcttacctgaccgtgctgacgcctgccgtcggt
ttcgtcgccgcgctgtggtattcgatccagttcggcttcaagcagcaagacatgatcctg
ttcggcgtcatgtacttcctgacgtcgttcggcgtcgagggcggtttgcaccgcttcttt
tcgcaccgcgcgttcaaggccgggccggtcgtgaccgcggttatcggcatcctcggctgc
atggcggcgcaagggcccatcctgttctgggcggcgacgcaccgcatgcaccacgtcttc
accgaccaggacggcgatccgcattcgccgcgggtgctgtcgcctggcctgcgcggccgc
atcaaagccttgtggcacggccatgtcggctggctgtttaccgtcaagcgcagcaactgg
agcacctatgtgccggacctgttcggcagcaagctggtgctgttcgtcaaccagcattac
ctgatctgggtgtttctcggcctggcgttgccggccgcagccggcgccgcactgagcggc
gtcgaaggcgcagtcggcgggctgctgtggggcggcctggcccggatcttcctgctcgac
caggtgacctgggcggtcaattcgatcggccataccttcggcaagcggcccaaccagacg
cgcgacaccagcggcaacatcggctggctggcgctggtgtcggccggcggcggctggcac
aacaaccatcacgccaacccggcgctggcgcacaacgatttccatttctggcagatcgac
accaccgcctgggtgatccggctgttaggactgctcggcctggcctgggatatccgccaa
cgccagagcgccgatccgctggaccagaaacttttcaataacgattaa

DBGET integrated database retrieval system