KEGG   Collimonas fungivorans: CFU_1553Help
Entry
CFU_1553          CDS       T01583                                 

Gene name
aceA
Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00630  Glyoxylate and dicarboxylate metabolism
cfu01100  Metabolic pathways
cfu01110  Biosynthesis of secondary metabolites
cfu01120  Microbial metabolism in diverse environments
cfu01200  Carbon metabolism
Module
cfu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CFU_1553 (aceA)
Enzymes [BR:cfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CFU_1553 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEK61385
UniProt: G0AJU0
Position
1835986..1837281
Genome map
AA seq 431 aa AA seqDB search
MTTREQQVAALAKDWAENPRWKGVTRNYSAEDVVRLRGSVQIEHTLAKRGADKLWKLLHE
EPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPLVVK
RINNTFQRADQIQWSEGKNDIDFFAPIVADAEAGFGGVLNAYELMKSMIDAGAAGVHFED
QLASVKKCGHMGGKVLVPSREAVEKLNAARLAADVSGTSTLVIARTDAEAADLLTSDVDE
NDKPFLTGERTVEGFYKTRPGIEQAISRALAYSPYADLVWCETGKPDLAFAKKFAEAVHA
KFPGKMLAYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMFNLAH
GYARNQMSAFVELQEAEFAAADKGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALHGST
EDEQFFEAKVA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgactacacgtgaacagcaagttgcagcactggccaaggactgggccgagaatccacgc
tggaagggcgttacccgcaattattctgcagaagacgtggtgcgtctgcgcggttcggtc
cagatcgaacacacgctggcaaaacgcggtgccgacaaactgtggaagttgctgcacgaa
gagccattcgtcaactccctcggcgcactgaccggcaaccaggcgatgcagcaagtcaag
gcaggcctgaaagcgatctacctgtcgggctggcaagtcgccggcgacgccaacctggcc
ggtgaaatgtatcccgaccagtcgctgtatccggccaactcggtgccgctggtggtcaag
cgcatcaacaatactttccagcgcgccgaccagatccaatggtcggaaggcaaaaacgat
atcgactttttcgcgcctatcgtggcggatgcggaagccggtttcggcggcgtgctgaac
gcctatgaactgatgaagtcgatgatcgatgccggcgctgccggcgtccacttcgaagac
cagctggcttcggtcaagaaatgcggccacatgggcggcaaggtgctggtgccaagccgc
gaagcagttgaaaagctgaacgctgcgcgcctggcggctgacgtttccggcacttcgacc
ctggtgatcgcccgcaccgatgccgaagcggccgacctgctgacttccgacgtcgacgag
aacgacaagccgttcctgaccggcgaacgcaccgtcgaaggtttctacaagacccgccca
ggcatcgaacaggctatctcgcgcgcactggcttattcgccgtacgctgacctggtgtgg
tgcgaaaccggcaagccggacctggctttcgccaagaaattcgcggaagcggtgcatgcc
aagttcccgggcaagatgctggcgtataactgttcgccatcgttcaactggaaaaagaac
ctggacgacgccaccatcgccaagttccagaaagaactgggcgccatgggctacaagttc
cagttcatcacgctggccggtttccatgcattgaactactcgatgttcaacctggcgcac
ggttatgcccgcaaccagatgtccgcattcgtcgaactgcaggaagccgaatttgctgcc
gccgacaagggtttcaccgcggtcaagcaccagcgcgaagtcggcaccggttatttcgat
gcagtgacccaggcgatccagcaaggccagtcctcgactaccgccttgcacggctcgacc
gaagatgaacagttcttcgaagccaaggttgcctga

DBGET integrated database retrieval system