KEGG   Collimonas fungivorans: CFU_1589Help
Entry
CFU_1589          CDS       T01583                                 

Gene name
cbbJ
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00010  Glycolysis / Gluconeogenesis
cfu00051  Fructose and mannose metabolism
cfu00562  Inositol phosphate metabolism
cfu01100  Metabolic pathways
cfu01110  Biosynthesis of secondary metabolites
cfu01120  Microbial metabolism in diverse environments
cfu01130  Biosynthesis of antibiotics
cfu01200  Carbon metabolism
cfu01230  Biosynthesis of amino acids
Module
cfu_M00002  Glycolysis, core module involving three-carbon compounds
cfu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFU_1589 (cbbJ)
   00051 Fructose and mannose metabolism
    CFU_1589 (cbbJ)
   00562 Inositol phosphate metabolism
    CFU_1589 (cbbJ)
Enzymes [BR:cfu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CFU_1589 (cbbJ)
Exosome [BR:cfu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CFU_1589 (cbbJ)
  Exosomal proteins of bladder cancer cells
   CFU_1589 (cbbJ)
  Exosomal proteins of melanoma cells
   CFU_1589 (cbbJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEK61421
UniProt: G0AJX6
Position
1873580..1874353
Genome map
AA seq 257 aa AA seqDB search
MKTWASVNMRRKLVAGNWKMNGSLVANAALLAEIKAGLAVAACDIAICAPAPYFAQCQAE
LAGSAIAWGGQDVSAHAGGAYTGEVAVSMLQDFACRYVIVGHSERRAYHAESDGLVAQKA
LRALLAGVTPIVCVGETLVEREAGQTDAVVGRQLAAVLDVLDAADLARIVVAYEPVWAIG
TGKTATPQMAQDVHLALRAMLAGKNPTAAVEVKILYGGSMKPDNAAELLAMPDIDGGLIG
GAALKAVDFLAIVAAAR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacttgggcctcggtaaatatgcgtcgtaaacttgtagccggtaactggaaaatg
aatggcagtctggttgccaatgctgcattactggcggaaatcaaggccgggctggcggtt
gccgcttgcgatattgctatctgcgcaccggctccttatttcgcgcaatgccaggccgag
cttgccggatcggcaattgcctggggcggacaagacgtttccgcgcacgccggcggcgct
tataccggcgaagttgcggtcagcatgttgcaggattttgcttgccgctacgttatcgtc
ggccattccgagcggcgcgcttatcacgcggaaagcgacggactggtggcgcaaaaggcg
ctgcgtgccttgctggcgggtgtgacgccaattgtctgcgtcggcgaaaccctggtcgag
cgtgaagccggccagaccgatgcggtagtagggcggcagctggcggcggtgctggatgtg
ctggatgcagccgacctggctcggatcgtggtggcgtatgagccggtatgggcgatcggc
accggcaagacagcgacgccgcagatggcgcaagatgtgcacctggccttgcgcgccatg
ctggcagggaagaatcccacggcggcagttgaagtaaagattttgtatggcggcagcatg
aagcctgacaacgctgccgaattgctggccatgccggacatagacggcggcctgattggc
ggcgcagcgttgaaggcggttgattttctggcgattgtcgctgcagcccggtag

DBGET integrated database retrieval system