KEGG   Collimonas fungivorans: CFU_3071Help
Entry
CFU_3071          CDS       T01583                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00010  Glycolysis / Gluconeogenesis
cfu00620  Pyruvate metabolism
cfu00640  Propanoate metabolism
cfu00680  Methane metabolism
cfu01100  Metabolic pathways
cfu01110  Biosynthesis of secondary metabolites
cfu01120  Microbial metabolism in diverse environments
cfu01130  Biosynthesis of antibiotics
cfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFU_3071
   00620 Pyruvate metabolism
    CFU_3071
   00640 Propanoate metabolism
    CFU_3071
  Energy metabolism
   00680 Methane metabolism
    CFU_3071
Enzymes [BR:cfu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CFU_3071
Lipid biosynthesis proteins [BR:cfu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CFU_3071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEK62896
UniProt: G0ACM2
Position
complement(3609599..3611266)
Genome map
AA seq 555 aa AA seqDB search
MSSALPADAPVAGASIPDYAQFYAEFSADSIAAELSGNLQSGINACVECCDRHATPGRIA
LLWEGKDGRSASYTFAQLKELSGRFANFLKQQGVQPGDRVAGLLPRTPELLVAILGTWRA
GAVYQPLFTAFGSKSIEYRVAASEAKLIVTDADNRHKLEEVLDCPPIMTVAAAPPAGDFG
FWPELEQQPSEFAPVMRKADDAFIMLFTSGTTGPAKGVAVPLRAMLAFYVYTRYAMDVRP
QDAFWNIADPGWAYGLYYCVTGPMLMGHAITFYEGSFTVESTYRIIDKYKITNLAGSPTA
YRLLIAGGAEAAGPVKGQLRAVSSAGEPLNPEVNRWFRQHLDCLINDHYGQTETGMVLCN
HHGLRHEVHMGSAGLAMPGYRLAVLDDDRNELGVGQPGVLAVDVRNSPVFWFQGYWRQDA
VDDDYYITGDTVETNQDGSISFIGRGDDIITSSGYRIGPFDVESALLEHAAVMEAAVVGK
PDPDRTELVKAFVVLSTGYQASAELVAELQQYVKHRLAAHSYPREIEFLTELPKTPSGKL
QRFILRNQEIAKAKI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagctttgccagccgatgccccggtcgcgggcgcaagcatcccggattatgcc
cagttttacgccgaattcagcgccgacagcatcgccgccgagctgtccggcaacctgcaa
agcggcatcaatgcctgtgtcgaatgctgcgaccgccacgccacgcccggtcgcattgca
ttgctttgggaaggcaaggatggccgcagcgccagttataccttcgcccagctcaaggaa
ttgtcggggcgcttcgccaatttcctgaagcagcagggcgtccagcccggcgaccgcgtc
gccggattgctgccgcgtacgccggaactgctggttgccatcctcggcacctggcgcgcc
ggcgcggtgtaccagcccttgttcaccgccttcggttcgaaatcgattgaataccgggtc
gccgccagcgaggcgaaactgatcgttaccgatgccgataaccgccacaagctggaggaa
gtgctggattgtccgcccatcatgaccgtcgccgccgcaccaccggccggcgacttcggt
ttctggccggagctggaacagcagccgagcgagtttgcgccggtgatgcgcaaggctgac
gacgccttcatcatgctgttcacttccggcacgaccgggccggccaagggcgtcgcggtg
ccgctgcgggcgatgctggctttttacgtctatacgcgctatgcaatggacgtgcggccg
caagacgctttctggaatatcgccgatcccggttgggcctatggcttgtactattgcgtc
accgggccgatgctgatgggccacgcgatcaccttctacgagggttcgttcacggtcgag
agcacctaccggatcatcgacaaatacaagatcaccaatcttgccggttcgcctaccgcg
taccggttgctgattgccggcggtgcggaagcagcggggccggtcaagggccagctgcgc
gccgtcagcagcgccggcgaaccgctgaatcccgaagtgaaccgctggttccgccagcat
ctggactgcctgatcaacgatcattacggccagaccgaaacgggcatggtgttgtgcaac
caccatggcttgcggcacgaggtgcacatgggttcggccggccttgccatgcccggttac
cggctggcggtgctggacgacgaccggaacgagctgggagtgggacagccgggggtgctg
gcggtggatgtgcgcaattcaccggtattctggttccagggttattggcggcaggatgcc
gtcgacgacgactattacatcaccggcgatacggtcgagaccaaccaggacggcagcatc
agctttatcgggcgcggcgacgatatcattacctcctccggttatcgcataggcccgttc
gatgtcgaaagcgcgttgctggagcatgcggcggtgatggaggcggcggtggtcggcaag
ccggatcccgatcgcactgaactggtcaaggcttttgtcgtcttaagtacaggctaccaa
gccagtgcggaactggtggccgagctgcagcaatacgtcaagcaccggctggcggcgcat
tcttatccgcgtgaaatcgaatttttaactgaactgccaaaaacgccgagcggcaaactg
cagcgcttcatcttgcgcaaccaggaaatcgccaaggctaaaatttaa

DBGET integrated database retrieval system