KEGG   Collimonas fungivorans: CFU_4415Help
Entry
CFU_4415          CDS       T01583                                 

Gene name
pyrB2
Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00240  Pyrimidine metabolism
cfu00250  Alanine, aspartate and glutamate metabolism
cfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CFU_4415 (pyrB2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFU_4415 (pyrB2)
Enzymes [BR:cfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CFU_4415 (pyrB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEK64236
UniProt: G0AEM8
Position
5138881..5140188
Genome map
AA seq 435 aa AA seqDB search
MTMSDQQTFLRDAMRRLNLTRDHFSDRIGVRKRALDTWLLPETSSEFRVMPDIVSKFVGE
ILDGELHHPASTQSVYSNKAGSPLREQIAYNGRPQLLSVGQFSRDSLEQLFRITDIMQPI
ARRQKVTRILEGAVLANLFFEASTRTRISFGAAFCRLGGSVCDTTGFTFSSMTKGESIYD
TSRVISGYADALVVRHPEQGAVDEFARATNIPVINGGDGPGEHPSQAILDLYTIQREFSR
LGKLVDGAHIVMVGDLKYGRTVHSLIKLLALYRNLRFTLVAPSTLEMPAHILERIARGGH
VVEQSTSLAQGLKGADIVYATRIQKERFADEAIEGYTPDFQINQALIDSTCSADTIVMHP
LPRDGRPGANDLSTDLNHDPRLAIFRQTDNGIPVRMAIFATLLGVENQVQHSMRDAGWRS
PRHVGPDDAAFDGVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgagtgaccaacagactttcctgcgcgacgccatgcgccgcctgaacctgacc
agggaccatttttccgatcgcatcggcgtccgcaagcgtgcattggacacctggctgctt
cccgaaacatcgagtgaattccgggtcatgcccgacatcgtcagcaaatttgtcggggaa
atcctggatggcgaattgcatcatccagcttcaacgcagagcgtatattcgaataaagcg
ggctccccgctccgcgaacagattgcctataacggcagaccccagctgctatcggtgggc
cagttctcacgcgattcgctggagcagctgttccgcatcacagacatcatgcagcccatt
gcgaggcgccagaaggtcacgcgcatcctcgagggtgccgtgctggccaatctgttcttt
gaagccagcacgcgcacgcgtatcagctttggcgcggcgttctgcaggctgggaggttcg
gtttgcgacactaccggttttaccttctcttcaatgaccaagggcgaatcgatttatgac
accagccgcgtcatcagcgggtatgccgacgccctggtggtcaggcaccctgaacaaggg
gcggtcgacgaatttgcccgcgccacgaatatcccggtaatcaatggcggcgacggcccg
ggcgagcaccccagccaggcgatcctcgacctgtacaccatacagcgcgaattctcgcgg
ctggggaaactggtcgacggcgcccacatcgtcatggtcggcgacctgaagtacggccgc
accgtgcattcgctgatcaagctgctggcgctgtaccgcaacctcaggttcacgctggtg
gcgccatcgacgctggagatgccggcccatatcctggaacgcatcgcgcgcggcggccac
gtggtggagcagtcgacctcgctggcgcaaggcttgaagggggctgacatcgtgtacgcg
acccggatccagaaagaacgcttcgccgacgaggcgatagagggctataccccggatttc
cagatcaaccaggcgctgatcgactccacctgcagcgccgacactatcgtcatgcatccc
ctgccgcgcgacggcaggcctggcgccaatgacctcagtaccgatcttaaccacgatccg
cgcctggcgatcttccgccagacggacaacggcataccggtgaggatggcgatctttgcg
accttgctgggtgtggaaaaccaggtccagcattcgatgcgcgacgccggctggcgctcg
ccgcggcatgtggggccggatgatgcggcatttgatggggtcgcctag

DBGET integrated database retrieval system