KEGG   Cystobacter fuscus: CYFUS_001416Help
Entry
CYFUS_001416      CDS       T05065                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00520  Amino sugar and nucleotide sugar metabolism
cfus01100  Metabolic pathways
cfus01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CYFUS_001416
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CYFUS_001416
Enzymes [BR:cfus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CYFUS_001416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: ATB36002
UniProt: A0A250IXP4
Position
complement(1701007..1702800)
Genome map
AA seq 597 aa AA seqDB search
MSLRPSHALALSLALLLGACTLAPAPRPAPSPPPPPLALPLVVPVPVDALADEVERLLTS
LSVEDKVGQLMMVGIGGREVDGAVEALVRGHRVGGVCLFKHNISDGEQVARLNRDLRGLL
SDGIPPFLALDQEGGNVVRVKDDVVVLPGNMALGATRSAQLAYAAGHAQAEDLRRLGFNM
NLAPVLDVNLNPRNPVIGSRSYGDSIPLVSELGRAFVRGQQDAGLVTVAKHFPGHGATDA
DSHRALPVMLESREEVLAQMEPFRAVIREGLDGLMTAHVAVPALTGDDAPATVHPRVLRG
LLRERLDFQGLVLTDELEMEPIARRYGVGQAAVLAVNAGADMVLVPWHSEKKREVHAALL
SAVRGGELSAARLDEAVRHILATKVRRGLFAPPRPVEERLATPRSAEHEEVAHRIARAAV
TLLRTDGEHFPLPSGVRLGVITAEDSLGDAIRERMPGARVLDVPAWPSRAQRARVRQRAR
ALALQSDVVVVGMINSRQLELVTLAASLGRPVVLVSMGLPYLAERATAARAVLAVYSYQP
TATEAAAAALFGEIGTPGRLPVGLGRLTFGYGLEVPRRQQAAAPPAPRGEAGGGRQR
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
gtgtccctccggccctcgcacgccctcgcgctctccctcgccctgctgctgggggcgtgt
accctggcgccggccccgcgcccggccccatcccctcccccgccgccgctcgcgctcccc
ctggtcgtccccgtcccggtggacgcgctcgccgacgaggtggagcggctgctcaccagc
ctctccgtcgaggacaaggtgggacaactgatgatggtgggcatcgggggacgcgaggtg
gatggcgccgtggaggcgttggtgcgcggccaccgggtggggggcgtctgcctcttcaaa
cacaacatctcggacggcgaacaggtggcccggctcaaccgggacctgcgcgggctgctg
tccgatggcatcccccccttcctcgcgctggaccaggaggggggcaacgtcgtgcgggtg
aaggacgacgtggtggtgctgccgggcaacatggccctgggggccacgcgctcggcacag
ctcgcctacgcggcggggcatgcccaggcggaggacctgcggcggctgggcttcaacatg
aacctggcgccggtgctggacgtcaacctcaacccgcgcaaccccgtcatcggcagccgc
tcctatggggactcgattcccctcgtgtccgagctggggcgcgccttcgtgcgcggccag
caggacgcggggctcgtcaccgtggccaagcacttccccggccatggcgccacggacgcc
gacagccaccgcgcgctgcccgtcatgctcgagtcgcgcgaggaggtgctcgcccagatg
gagcccttccgggccgtcatccgcgagggactggacgggttgatgaccgcgcacgtcgcc
gtgcccgccctcaccggagacgacgcgcccgccaccgtccacccccgggtgctgcgcggc
ctcttgcgcgagcggctcgacttccagggtctggtcctcaccgacgagctggagatggag
cccatcgcccgacgctacggcgtgggtcaggccgcggtgctggcggtgaacgccggcgcg
gacatggtgctcgtgccctggcactcggagaagaagcgcgaggtgcacgcggcgctcctg
tccgcggtgcgcggtggcgagctgtccgccgcccgcctggatgaagcggtgcgtcacatc
ctcgccaccaaggtgcgccgggggctgttcgccccgccccgccccgtggaggagcggctg
gccaccccgcgctcggccgagcacgaggaggtcgcccaccgcatcgcccgcgccgccgtc
accctgctgcgcaccgacggcgagcacttccccctgccctccggcgtgcgcctgggcgtc
atcaccgccgaggactcgctcggagacgccatccgcgagcggatgccgggtgcccgggtg
ctggacgtgcccgcgtggccctcgcgtgcccagcgcgcacgcgtgcggcagcgggcccgc
gccctcgcgctccagtcggacgtggtggtggtggggatgatcaactcgcgccagctggag
ctcgtcaccctggccgcctcgctcggacggcccgtggtgctcgtgtccatgggcctgccc
tacctggccgagcgagccaccgcggcgcgggcggtgctcgccgtctactcgtaccaaccc
accgccaccgaggccgccgcggccgcgctcttcggggagattggcacgccgggccggctg
cccgtgggacttggccggctcaccttcgggtacggcctggaggtgccacgccgtcaacag
gccgccgccccacccgcccctcggggagaggcgggaggcggccgccagcgctag

DBGET integrated database retrieval system