KEGG   Cystobacter fuscus: CYFUS_002229Help
Entry
CYFUS_002229      CDS       T05065                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
cfus  Cystobacter fuscus
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CYFUS_002229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Chitin_bind_4 YidC_periplas
Motif
Other DBs
NCBI-ProteinID: ATB36814
UniProt: A0A250IYL0
Position
2705584..2705967
Genome map
AA seq 127 aa AA seqDB search
MSSVTTEGIRVSVKPSYWPERSSPDAHQYAFMYTVEITNTGQEPAQLRSRHWVITDASGK
VEEVRGEGVVGKQPRLEPGERFEYTSWAQLRTPFGSMRGSYTLVRPDGRQFEARIGEFAL
TQPHSLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgtcaccaccgaaggcattcgcgtctccgtcaagccctcctactggccggag
cgcagctccccggacgcccaccagtacgccttcatgtacacggtggaaatcaccaacacc
ggccaggagccggcccagctgcgcagccgccactgggtcatcaccgatgccagcggcaag
gtggaggaggtgcggggcgagggtgtcgtgggcaagcagccccggctcgagcccggcgag
cgcttcgagtacacgagctgggctcagctgcgcacgcccttcggctccatgcggggctcc
tacaccctggtgcgtcccgacggccgccagttcgaggcccgcatcggtgagttcgccctc
acccagccccactcgctgcactga

DBGET integrated database retrieval system