KEGG   Cystobacter fuscus: CYFUS_006328Help
Entry
CYFUS_006328      CDS       T05065                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00670  One carbon pool by folate
cfus01100  Metabolic pathways
cfus01120  Microbial metabolism in diverse environments
cfus01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CYFUS_006328
Enzymes [BR:cfus01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     CYFUS_006328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Metallophos_2
Motif
Other DBs
NCBI-ProteinID: ATB40866
UniProt: A0A250JCF8
Position
7943177..7944049
Genome map
AA seq 290 aa AA seqDB search
MKIRNRLNPSSPCFSFEFFPPKTDAGTANLLQTLEDLAPLEPGFVSVTYGAGGSTRDRTV
DLVTRIKRDTGIEAMAHLACLGHTREELRELLRRLEEAKIDNVLVLRGDVPQGASPDTLA
NTDFRHAADLVRFIREEDFDFSLGGACYPEGHVETRSRDEDLLHLKAKVDAGLDFVITQL
FFDNAFYFDFVERARRVGINVPIVPGIMPITNHEQIQRFTRLCGATIPMRLALQLEQLKD
QPEALVQLGVAHATVQCMELLSRGVPGIHFYTLNKSPATRMIVSALRART
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccgcaatcgcctgaacccgtccagcccctgcttctccttcgagttcttcccg
ccgaagacggacgcgggaaccgccaacctgctgcagacattggaggacctggccccactc
gagccggggttcgtgtccgtcacctatggcgcgggaggcagcacgcgcgatcgcacggtg
gatctcgtcacgcgcatcaagcgcgacacgggcatcgaggccatggcccacctcgcgtgc
ctgggccacacgcgcgaggagctgcgcgagctgttgcggcggctcgaggaggcgaagatc
gacaacgtgctggtgctgcgcggcgacgtgccccagggcgcctcccccgacaccctcgcg
aacacggacttccgtcatgccgcggatctcgtgcgcttcatccgcgaggaggatttcgac
ttcagcctgggcggggcgtgctatccggagggccacgtggaaacgcgctcgcgggacgag
gatctgctgcacctcaaggccaaggtggacgccggcctggacttcgtcatcacccagctc
ttcttcgacaacgccttctacttcgacttcgtcgagcgggcgcgccgcgtcggcatcaac
gtccccatcgtcccgggcatcatgcccatcaccaaccacgagcagatccagcgcttcacc
cgcctgtgcggcgccaccatccccatgcgcctggcactccaactggaacaactcaaggac
cagccggaggccctggtgcagttgggggtggcgcacgccacggtgcagtgcatggagctg
ctctcgcggggtgtgccgggaatccatttctacacgctcaacaaatcacccgccacgcgg
atgatcgtgagcgccttgagggcccgtacatga

DBGET integrated database retrieval system