KEGG   Cystobacter fuscus: CYFUS_009361Help
Entry
CYFUS_009361      CDS       T05065                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00790  Folate biosynthesis
cfus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CYFUS_009361
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfus04147]
    CYFUS_009361
Enzymes [BR:cfus01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     CYFUS_009361
Exosome [BR:cfus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CYFUS_009361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ATB43880
UniProt: A0A250JJR5
Position
11702284..11702595
Genome map
AA seq 103 aa AA seqDB search
MAYDKTQLSAAELERFLAEHTAWKQEGGMLRRTYEAPSFLAGIEFVTRVAKAAEAADHHP
DIDIRWRKVTLALVTHDAGGLTWRDTKLAAEADTLFAQVASAS
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggcctacgacaagacgcagttgagcgccgcggaactcgagcgtttcctcgccgagcac
accgcgtggaagcaggagggagggatgctgcggcgcacctacgaggcgccgagcttcctg
gcgggcatcgagttcgtgacccgggtggcgaaggcggccgaggcggcggaccatcacccg
gacatcgacatccggtggcgcaaggtgacgctggcgctggtgacgcacgacgcgggcggg
ctcacctggcgcgacacgaagctggcggccgaggcggacaccctgttcgcccaggtggcg
tccgcgagctga

DBGET integrated database retrieval system