KEGG   Cystobacter fuscus: CYFUS_009703Help
Entry
CYFUS_009703      CDS       T05065                                 

Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00051  Fructose and mannose metabolism
cfus01100  Metabolic pathways
cfus01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CYFUS_009703
Enzymes [BR:cfus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CYFUS_009703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ATB44216
UniProt: A0A250JM97
Position
12095369..12096028
Genome map
AA seq 219 aa AA seqDB search
MSAPDERALREEMIATGRRMNATGLNQGTSGNLSVRVEGGFLLTPSGMDYDTLAPGDMVR
MRMDGTYEGHREPSTEWRIHRDILATRPEVGGVLHAHSMFSTSLACLRRPIPAFHYMVTR
AGGEDIRCSDYATFGTEELSRHVLVALEGRLACLMANHGMVALGATLAGAFKLAVEVETL
AAMYWRALQVGEPVLLESAEMQRVLEKFKTYGQKPTRGG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcaccggacgagcgcgcgctgcgcgaggagatgatcgccacgggccgccggatg
aacgccacggggctcaaccagggcaccagtggcaacctgagcgtgcgggtggagggcggc
ttcctgctcacgccctcggggatggactacgacacgctcgcgccgggggacatggtgcgg
atgcggatggacggcacgtacgaggggcaccgcgagccgtccaccgagtggcgcatccac
cgggacatcctcgccacgcggcccgaggtggggggagtgctgcacgcgcattccatgttc
agcacgagcctggcgtgcctgcgccggccgattccggccttccactacatggtgacgcgc
gcggggggcgaggacatccggtgctcggactacgccacgttcggcaccgaggagctgtcg
cggcacgtgctggtggcgctggagggccggctggcgtgcctgatggccaaccacggcatg
gtggcgttgggggcgacgctggcgggggcgttcaagctggcggtggaggtggagacgctc
gcggccatgtactggcgcgcgctccaggtgggcgagcccgtgctgctggagtcggcggag
atgcaacgggtgctggagaagttcaagacgtacggccagaagcccacgcgcggaggctga

DBGET integrated database retrieval system