KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_0511Help
Entry
CFVI03293_0511    CDS       T03000                                 

Gene name
fbaA
Definition
(GenBank) fructose-bisphosphate aldolase, class IIA
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00010  Glycolysis / Gluconeogenesis
cfv00030  Pentose phosphate pathway
cfv00051  Fructose and mannose metabolism
cfv00680  Methane metabolism
cfv01100  Metabolic pathways
cfv01110  Biosynthesis of secondary metabolites
cfv01120  Microbial metabolism in diverse environments
cfv01130  Biosynthesis of antibiotics
cfv01200  Carbon metabolism
cfv01230  Biosynthesis of amino acids
Module
cfv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFVI03293_0511 (fbaA)
   00030 Pentose phosphate pathway
    CFVI03293_0511 (fbaA)
   00051 Fructose and mannose metabolism
    CFVI03293_0511 (fbaA)
  09102 Energy metabolism
   00680 Methane metabolism
    CFVI03293_0511 (fbaA)
Enzymes [BR:cfv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     CFVI03293_0511 (fbaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase PEP-utilizers DUF4003
Motif
Other DBs
NCBI-ProteinID: AHE93845
UniProt: W0DA08
Position
520319..521383
Genome map
AA seq 354 aa AA seqDB search
MGVLDIVKAGVLSGDDITKLYAYAKQEGFAIPAVNVVGSNSVNAVLEAAKRANSPVIIQF
SNGGAGFFAGKSCPKPDILGAIVGAKHVHLLAREYGIPVVLHTDHAARKLLPWIDGLIEA
SREHKKVFGRPLFSSHMLDLSEESLEENISTCKEYLKNLSELDISLEIELGVTGGEEDGV
DNSGVDNSLLYTQPSEVAYAYSELGKISDKFSIAASFGNVHGVYKPGNVVLRPEILKNSQ
EFIKHKFSLNDDKPVNFVFHGGSGSELKDIKNAVSYGVVKMNIDTDTQWAFWDGVREYEA
AHHGYLQSQIGNPEGEDKPNKKYYDPRKWLRSGEESMIKRLLEAFDNLNCMNKN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggagttttggatattgtaaaagcaggcgtactaagtggtgatgatatcacaaaactc
tacgcttatgccaaacaagaagggttcgctatcccagcagtaaatgtagtaggcagcaat
tccgtaaatgcagtgttagaagccgcaaaaagagcaaactcacctgttataatccaattt
agcaatggcggcgccggtttttttgccggtaagtcatgtcctaagccagatattttaggc
gctatagtaggtgctaagcatgttcatctgcttgctagagagtacggcattccagtagtt
ttgcatacagatcatgccgctagaaagttactgccatggatagatggtcttatagaggct
agtcgtgaacataaaaaagtattcggaagaccgctttttagttctcatatgcttgatctc
agcgaagagagcttagaggaaaatatctctacttgtaaagagtatttaaaaaatttaagc
gaacttgatataagtcttgaaatcgagcttggagttaccggaggagaagaggacggtgtt
gataattctggtgtagataactctcttctttatactcaaccatcagaagttgcttatgct
tattccgagttaggcaaaattagcgataaatttagtatagcagctagttttggaaacgta
catggagtatataagccgggaaatgttgttcttcgtccggaaattcttaaaaattcacaa
gagtttattaagcacaaattctctctaaatgacgacaagccggtaaatttcgtttttcat
ggcggtagtggtagtgagttaaaagatattaaaaacgccgtaagttatggtgttgttaaa
atgaatatcgatactgacacacaatgggctttttgggatggagtgagagagtacgaagcg
gctcatcacggatatctgcaatctcagataggaaatcccgagggagaagacaagccaaat
aaaaaatactacgatcctagaaaatggttaagatctggtgaagagagtatgataaaaaga
cttcttgaagcttttgataatttaaactgtatgaataaaaattag

DBGET integrated database retrieval system