KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_0607Help
Entry
CFVI03293_0607    CDS       T03000                                 

Gene name
gatA
Definition
(GenBank) Glu-tRNA(Gln) amidotransferase, subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00970  Aminoacyl-tRNA biosynthesis
cfv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CFVI03293_0607 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cfv03029]
    CFVI03293_0607 (gatA)
Enzymes [BR:cfv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CFVI03293_0607 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CFVI03293_0607 (gatA)
Mitochondrial biogenesis [BR:cfv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CFVI03293_0607 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase YcaO
Motif
Other DBs
NCBI-ProteinID: AHE93928
UniProt: W0D9S5
Position
620853..622214
Genome map
AA seq 453 aa AA seqDB search
MISLKDAIKLSSSDIVKLRKNLKDKIKDNRQLGAYIEQLTNSDISDEYAGVPIAIKDNIQ
VKNWSITSCSKILQGYVAPYHATVVEKLLKAGLAPFGRTNMDEFAMGSTTESSFYGKTLN
PLDHTRVPGGSSGGSAAAVSAGLAIAALGSDTGGSIRQPAAFCGCVGFKPTYGRVSRYGL
GAYSSSLDQIGPITRSVEDAALLYDIIAGHDPKDSTSSNLENISTSDKLNSDRKLTIAVI
KNYVDGASQDVKDSLYKVVDKLKEAGHNIIYKDLSNSKYDIAAYYIIATAEASANLSRYD
GVRYGRRADSNSLGQMYSKTRGEGFGVEVQRRMLLGTFVLSSGYYDAYYIKAQKARAFIK
LEYEEILNEADIMLMPVAPSVAYKFGELSDPLSAYLSDIYTIGVNLAGLPAITVPVQSDK
NGLNISAQLIGGAWKEQDVLDAAFGLEKLVKGN
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtgataagcttaaaagatgcgataaagctaagtagtagcgatatagtaaagcttcgtaaa
aatttaaaagataagataaaagataatagacaattaggcgcttatatagaacagctaact
aatagcgatataagtgatgagtatgcaggtgttccaatcgctataaaagacaatattcaa
gtcaaaaattggagcataacaagttgttctaagatcttgcaaggttacgtagctccatat
cacgctacggtcgtagaaaagcttttgaaagccggacttgcaccgtttggtcgtacgaat
atggatgagtttgccatgggaagcacaactgaaagttcgttttacggcaaaactttaaat
ccgcttgatcatactagagttccaggaggcagtagtggcggtagcgctgcagcagtttcg
gctggactagcgatagctgctttgggaagcgatactggaggaagcatacgccaacctgct
gcgttttgcggatgcgtcggctttaagcctacttacggaagagttagcagatatggactt
ggagcttattctagtagcttagaccagataggaccgataacaagaagcgttgaagatgcc
gcacttctttatgatattatagccggacatgatccaaaagatagcacaagctcaaattta
gaaaatataagcacctcggataaattaaacagcgatagaaaacttacgatagcagttata
aaaaactatgttgatggggctagccaagatgttaaggactcgctttataaggtagttgat
aagctaaaagaagccggtcataacataatttataaagatctttctaactcaaaatacgat
atagctgcttattatattatagctacagcagaagctagtgcgaatcttagtcgttatgac
ggtgttagatatggtaggagagcggactcaaactctcttgggcagatgtattcaaaaaca
agaggcgagggatttggtgtagaagtgcaaagaagaatgcttcttggaacatttgtttta
agtagcggatactatgatgcttattatataaaagcacaaaaagcaagagcatttataaaa
ctagaatatgaggagatattaaatgaagccgatataatgctaatgccagtagctcctagt
gtagcttataaatttggagagttaagcgatccgcttagtgcgtatcttagcgatatatat
actataggtgtaaatttggccggacttcctgctataacagtaccggtgcaaagtgataaa
aatgggctaaatatctcagctcagctcatcggcggtgcgtggaaagaacaagatgtctta
gacgctgcatttggtttggaaaaattagttaaaggaaactaa

DBGET integrated database retrieval system