KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_1606Help
Entry
CFVI03293_1606    CDS       T03000                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00740  Riboflavin metabolism
cfv00790  Folate biosynthesis
cfv01100  Metabolic pathways
cfv01110  Biosynthesis of secondary metabolites
cfv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CFVI03293_1606 (ribA)
   00790 Folate biosynthesis
    CFVI03293_1606 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CFVI03293_1606 (ribA)
Enzymes [BR:cfv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CFVI03293_1606 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AHE94883
UniProt: W0DCT5
Position
1604244..1604831
Genome map
AA seq 195 aa AA seqDB search
MEIIKSNIANLPSRFGKFQIKSYKEGCCKEHLTIFSPNLDVTKTVNVRIHSECLTGDAIG
SLKCDCRDQLEASLKYINKHGGMVIYLRQEGRNIGLLNKVNAYALQDNGLDTIEANHQLG
FKADERTYEIVDFILKDFGIKSINLLTNNPLKLASLTCVNIEKRIPIEIESNEFNKDYLK
VKKEQMGHMLDEFTR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggaaataataaaatcaaatatcgcaaacctacctagcagatttggcaaatttcaaata
aaatcatacaaagaaggctgctgcaaagagcatttgactatattttctccgaatttagac
gtaacaaagacagtaaatgtcagaattcactcagaatgcttaaccggagacgctatagga
agtttaaaatgcgactgccgcgaccaactagaagctagtttaaaatatataaacaaacac
ggaggaatggtaatttatctacgtcaagaaggtagaaatatagggcttttaaataaagta
aatgcttacgctttgcaagataatggacttgatacaatagaagcaaatcatcaattaggc
tttaaagccgatgaaagaacgtacgaaatagtagattttatactaaaagattttggtata
aaaagtataaatttactcacgaataatcctctaaaactagctagtcttacttgcgtaaat
atagaaaaaagaattcccatagagatagaatctaatgaatttaataaagattatttaaag
gtgaaaaaagagcagatggggcatatgttagatgaatttaccagataa

DBGET integrated database retrieval system