KEGG   Campylobacter fetus subsp. venerealis 84-112: CSG_2140Help
Entry
CSG_2140          CDS       T03740                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cfz  Campylobacter fetus subsp. venerealis 84-112
Pathway
cfz00051  Fructose and mannose metabolism
cfz01100  Metabolic pathways
cfz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cfz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CSG_2140
Enzymes [BR:cfz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CSG_2140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II CENP-C_C
Motif
Other DBs
NCBI-ProteinID: CDF64134
Position
201966..202457
Genome map
AA seq 163 aa AA seqDB search
MNIEYSMGEIKKISASMFKKNFFGIFHGSISARIEHNQFVINKKDAIFDGLSNDDLTLLY
SKKDYRWNDASIDSDIHLNIYKNIGEAKYICYAMPPYLTAYSMDHITIEPRDYFGYMKFD
NIFIYDIKQFDDWYERAPSEICRYMIEKKQQYHGYKRIWCLCI
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaatactctatgggtgagataaaaaagatatccgcatctatgtttaaaaag
aattttttcggtatattccatggatctatatcggctagaatagagcataatcagtttgtt
atcaataaaaaagatgcgatatttgatggacttagcaacgatgatctgactttgctttat
tccaaaaaagattatagatggaacgatgctagcatagatagcgatatacatctaaatata
tataaaaatatcggcgaggcaaaatatatttgttacgcgatgccgccttatttgacagct
tacagcatggatcatataactattgaaccgcgagattactttggatatatgaaatttgat
aatatatttatttatgatataaagcaatttgatgattggtatgagagagctccatctgag
atatgtaggtatatgatagaaaaaaaacagcaatatcatggttataaaaggatatggtgt
ttatgtatatga

DBGET integrated database retrieval system