KEGG   Campylobacter fetus subsp. venerealis 84-112: CSG_7840Help
Entry
CSG_7840          CDS       T03740                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
cfz  Campylobacter fetus subsp. venerealis 84-112
Pathway
cfz01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cfz00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CSG_7840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cfz01011]
    CSG_7840
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfz03036]
    CSG_7840
Enzymes [BR:cfz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     CSG_7840
Peptidoglycan biosynthesis and degradation proteins [BR:cfz01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   CSG_7840
Chromosome and associated proteins [BR:cfz03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CSG_7840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 AMIN
Motif
Other DBs
NCBI-ProteinID: CDF64702
Position
781808..783427
Genome map
AA seq 539 aa AA seqDB search
MGKIVRVLLLFILSAFAFGADFSSWFGEFDTKFYSSAKQEQLRIYHDLKGVYVHSILNDN
KDLKIQTLLRLVDGSKKLGLDYKVYESELKNYENQDIISYDQTKELVKKPEKQTINKNII
PKVETSAKKIESKEQKVENEVQKSSSKENEDEVKKPLKVLKFSSDDDSFVLSLNRDMDEK
EIKTFELNTKELYKRIYDINAILTTQFKKPTQKISDDIRVAQFDKDTVRVVFYSDKKQNI
NTKFENKNIIFFIKDGVSKKPVANLDSKSQTQKTSDKTAQKNKTQTSVAAKTAKKEDDKK
SQTQNKNTIKNIPRNKTIVLDAGHGGKDAGAVGSRTLYEKNVVLKVALKAGKILKNRGYK
VYYTRDKDKFIGLRNRTSFANDKMADLFISIHANAAPNSKKAPEMQGIETFFLSPTRSER
SMRAANLENKSDTDEMNYFTKISFLNFLNREKIIASNKLAIDIQTNLLSSVRTNYNVSDG
GVREAPFWVLVGALMPAVLIETGYITHPKEGKLLANDAYADKLAEGIANGIDDYFAKNR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaatagttagagttcttttactatttatcctaagtgcgtttgcattcggagct
gatttttcgtcttggtttggcgagtttgatacgaaattttatagctcggcaaaacaagaa
cagctccgtatttatcatgatttaaaaggcgtttatgtacattctatattaaacgacaat
aaagacttaaaaatacaaactcttttaagattggtagatggctcaaaaaagcttgggttg
gattataaagtttatgaaagcgaacttaaaaattatgaaaatcaggatattataagctac
gatcaaactaaagaattagtaaaaaaacctgaaaagcagactataaataaaaatattatc
ccgaaagttgaaacttctgctaaaaaaatagaatctaaagagcaaaaagtagagaatgaa
gttcaaaaaagcagctcaaaagagaacgaagatgaggtaaaaaaacctctaaaggtactt
aaatttagtagcgatgatgatagttttgttttgagtttaaatagggatatggatgaaaaa
gagattaaaacttttgaattaaatacaaaagagctatataaaagaatttatgatattaat
gcgattttaactactcaatttaaaaaaccaactcaaaaaatatctgatgatataagagtc
gctcagtttgataaagatacggtaagggttgtattttatagtgataaaaaacaaaatatc
aatactaaatttgaaaataaaaatataatttttttcataaaagacggagtatctaaaaaa
ccagttgctaatttagactcaaaatctcaaactcaaaaaactagtgataaaaccgctcaa
aaaaataagactcagacctctgttgcggctaaaacagctaaaaaagaagatgataaaaaa
tctcaaacacaaaataaaaataccataaaaaatatacctaggaacaaaactatagttttg
gatgcgggacacggtggaaaggacgccggagcggttggttcaagaacgctttatgaaaaa
aatgttgttttaaaagtagctttgaaagctggaaagatactcaaaaatagaggttacaaa
gtttattatacgcgagataaagataaatttataggtcttagaaatagaactagttttgcc
aatgataagatggctgatctttttatatctattcatgctaacgccgcgccaaatagtaaa
aaagctcctgaaatgcaaggtatagaaacattttttcttagtccaactagaagtgagaga
agtatgcgagcagcaaatttagagaataaatcagatacagatgagatgaattatttcact
aaaattagctttttaaatttcttaaatagagaaaaaataattgcctcaaataaacttgct
atcgatatccaaacaaatcttttaagctctgtgagaactaattataacgtgtctgatgga
ggagtaagggaagctcctttttgggttttagtaggtgcgcttatgccagcagttcttata
gaaactggatatattactcatccaaaagagggaaaactccttgcaaatgatgcttacgcc
gataaattagcggagggaatcgcaaatggaattgatgattattttgcgaaaaatagatga

DBGET integrated database retrieval system