KEGG   Campylobacter fetus subsp. venerealis 84-112: CSG_8390Help
Entry
CSG_8390          CDS       T03740                                 

Definition
(GenBank) Phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cfz  Campylobacter fetus subsp. venerealis 84-112
Pathway
cfz00564  Glycerophospholipid metabolism
cfz01100  Metabolic pathways
cfz01110  Biosynthesis of secondary metabolites
Module
cfz_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:cfz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CSG_8390
Enzymes [BR:cfz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CSG_8390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CDF64750
Position
complement(831101..831892)
Genome map
AA seq 263 aa AA seqDB search
MNYNKFSNYFGLVAHYKFPKTIQNLINSWYIKKFNINMEEFKSADKYNSLNELFTRTLNK
QRKLEDGFISPSDGICLECKKGDKQTAYSIKNYSYSINELLGKSLKKGELESQFEYINIY
LSPKDYHHYHSPCYLDIMSLHYIPGKLFSVAKNWLEKVDNLYCKNERVILKAKLNNEKQI
WLVFIGAWNVGKMKFDFEPRINTNIEAKAVYYEYSNLNLKKGDHIGNFELGSTIVMISEK
NSIEYNVKADDTLKFGKNIGKIL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaataaattttcaaattatttcggacttgtagctcactataaatttccaaaa
actattcaaaatttaataaatagttggtatataaaaaaatttaatataaatatggaagaa
tttaaaagtgcagataaatataacagcttaaatgagctatttacacgtactttaaataaa
caaagaaagctagaagatggatttataagccctagtgacggaatatgccttgagtgcaaa
aaaggagataagcaaacagcttatagtataaaaaactactcttatagtattaatgagctt
cttggtaaaagccttaaaaaaggtgaattagagtcacagtttgagtatataaatatatac
ttatctcctaaggattatcaccattatcattctccgtgttatttggatattatgagtttg
cactatattccaggaaagctttttagcgtagcaaaaaattggctagaaaaagttgataat
ctatattgcaaaaatgagagagtgatactaaaagctaaattaaacaatgaaaaacagatt
tggctagtatttataggggcttggaatgtcggtaaaatgaaatttgattttgaaccgcga
ataaatacaaatatagaagccaaagccgtatattatgaatattcaaatttaaatttaaaa
aaaggagatcatataggaaattttgaactaggatcaactattgtgatgataagtgaaaaa
aatagtatagaatataacgtaaaagccgacgatacactaaaatttggaaaaaatataggc
aaaatactataa

DBGET integrated database retrieval system