KEGG   Cellulomonas gilvus: Celgi_1378Help
Entry
Celgi_1378        CDS       T01537                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cga  Cellulomonas gilvus
Pathway
cga00010  Glycolysis / Gluconeogenesis
cga00520  Amino sugar and nucleotide sugar metabolism
cga01100  Metabolic pathways
cga01110  Biosynthesis of secondary metabolites
cga01120  Microbial metabolism in diverse environments
cga01130  Biosynthesis of antibiotics
cga01200  Carbon metabolism
Module
cga_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celgi_1378
   00520 Amino sugar and nucleotide sugar metabolism
    Celgi_1378
Enzymes [BR:cga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Celgi_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEI11897
UniProt: F8A342
Position
complement(1507452..1508207)
Genome map
AA seq 251 aa AA seqDB search
MSHHSHLAFGIDIGGSGIKGAPVDLEKGEFAADRLRIPTPQPATPDAVAQTVAQIVDSFD
LDKKVPIGVTFPAVMLHGVAQSAANVDDSWIGTDAQALFSEATGRSVVAVNDADAAGVAE
ARYGAARGVDGVVLVVTLGTGIGSALVVDGNLVPNTELGHLEIDGHDAETRASDAARDRD
GLDFEAWAQRLQRYFSVVENLFWPDLFVVGGGVSKHHEKFLPLLDLRTRIVPAALRNAAG
IVGAAALAARH
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagccatcactcgcacctcgcgttcggcatcgacatcggcggcagcggcatcaagggc
gctcccgtcgacctggagaagggtgagttcgccgcggaccggctgcgcatcccgacaccg
caaccggccacccccgacgcggtcgcgcagacggtcgcgcagatcgtcgactcgttcgac
ctcgacaagaaggtgccgatcggcgtgacgttcccggccgtgatgctgcacggcgtcgcg
cagtccgcggccaacgtcgacgactcgtggatcggcaccgacgcgcaggcgctgttctcc
gaggcgaccggtcgcagcgtcgtcgcggtcaacgacgccgacgcggccggcgtcgccgag
gcgcgctacggcgcggcccgcggcgtcgacggcgtggtgctggtggtcacgctcggcacg
ggcatcggctccgcgctcgtggtcgacggcaacctggtgccgaacaccgagctcgggcac
ctggagatcgacgggcacgacgccgagacgcgcgcgtccgacgccgcacgcgaccgggac
ggcctcgacttcgaggcgtgggcgcagcgcctgcagcggtacttctccgtggtcgagaac
ctgttctggccggacctgttcgtggtgggcggcggcgtgagcaagcaccacgagaagttc
ctgccgctgctggacctgcgcacgcgcatcgtccccgccgcgctccgcaacgcggccggc
atcgtcggcgccgccgcactggccgcgcggcactga

DBGET integrated database retrieval system