KEGG   Cellulomonas gilvus: Celgi_1685Help
Entry
Celgi_1685        CDS       T01537                                 

Definition
(GenBank) malate/quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cga  Cellulomonas gilvus
Pathway
cga00020  Citrate cycle (TCA cycle)
cga00620  Pyruvate metabolism
cga01100  Metabolic pathways
cga01110  Biosynthesis of secondary metabolites
cga01120  Microbial metabolism in diverse environments
cga01130  Biosynthesis of antibiotics
cga01200  Carbon metabolism
Module
cga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celgi_1685
   00620 Pyruvate metabolism
    Celgi_1685
Enzymes [BR:cga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Celgi_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: AEI12196
UniProt: F8A5P1
Position
complement(1831770..1833293)
Genome map
AA seq 507 aa AA seqDB search
MPSQDPNPRDIATDDGRDAPLDVVLIGGGVMSATLASLLRSLEPTWRIEIHERRDGVAQE
SSNPWNNAGTGHAALCELNYTPQRPDGSIDITKAVTINEQFELSRELWHHLAGQGRLPVG
TEFVSTTPHMTFVRGEEGVDYLRRRFEALRAHPLFSDLEFSTDPDQIAQWAPLLMADRDP
AEPVAATRAAGGTDVDFGALTRAMVQDAVDHGATLHLESEVTRLRQRRDGTWRLTVRDRR
WNGRRRARTVDARFVFIGAGGGALGLLQKSGIPEAKGYGGFPISGQFLRTTNPAVVREHH
AKVYGRAEIGAPPMSVPHLDTRVVEGQTALMFGPYAGWSMKFLKHGSWLDLVRSIRPGNL
VPMLSVGLRNLDLLRYLIGEVTASSQDRFRTLRQFMPTARPGDWELITAGQRVQVIKKVR
GGGVLEFGTELVTSADGTIAGLLGASPGASTAVATMVDLLERCFADRVEAWRPALREMMP
SLGGGTWDESFELDRLVDEAVTADHSA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgccttcccaggacccgaaccccagggacatcgcgaccgacgacggccgcgacgcgccg
ctcgacgtcgtcctgatcggcggcggggtgatgagcgcgacgctcgcgagcctgctgcgc
tcgctcgagcccacgtggcgcatcgagatccacgagcgccgcgacggcgtggcgcaggag
agctccaacccctggaacaacgcgggcacgggccacgcggccctgtgcgagctcaactac
acgccgcagcggcccgacggctcgatcgacatcaccaaggccgtgacgatcaacgagcag
ttcgagctgtcgcgtgagctgtggcaccatctggccggccagggccggctccccgtcggg
accgagttcgtctccaccaccccgcacatgacgttcgtgcggggcgaggagggcgtggac
tacctgcgccgccggttcgaggcgctgcgcgcccacccgctgttctccgacctggagttc
tcgaccgacccggaccagatcgcgcagtgggccccgctgctcatggcggaccgcgacccc
gcggagccggtcgcggccacgcgtgccgcgggtggcaccgacgtcgacttcggcgcgctg
acgcgcgcgatggtgcaggacgcggtcgaccacggcgccacgctccacctcgagtcggag
gtgacgcggctgcggcagcgacgcgacggcacgtggcgcctgacggtgcgggaccggcgc
tggaacgggcgtcgccgcgcccgcaccgtggatgcgcggttcgtgttcatcggcgcgggc
ggcggcgcactgggtctgctgcagaagtccggcatccccgaggccaaggggtacggcggg
ttcccgatcagcgggcagttcctgcgcacgacgaaccccgcggtggtgcgcgagcaccac
gccaaggtctacggccgcgcggagatcggggcgcccccgatgtcggtgccgcacctcgac
acgcgcgtggtcgaggggcagacggcgctcatgttcggcccgtacgcgggttggagcatg
aagttcctcaagcacggctcgtggttggacctcgtgcgctcgatccggcccgggaacctg
gtgccgatgctgtccgtgggcctgcgcaacctggacctgctgcgctacctcatcggtgag
gtcacggcgtcgtcgcaggaccggttccgcacgctgcgccagttcatgcccaccgcgcgc
ccgggcgactgggagctcatcaccgcgggtcagcgcgtgcaggtcatcaagaaggtgcgc
ggcggcggggtgctcgagttcggcaccgagctggtcacgtcggccgacgggacgatcgcg
ggcctgctgggcgcctcccccggcgcctcgacggccgtggcgacgatggtcgacctgctc
gagcggtgcttcgcggaccgcgtggaggcctggcgccccgcgctgcgggagatgatgccg
agcctcggcggcggcacgtgggacgagtccttcgagctggaccgcttggtcgacgaggca
gtcacggccgatcattcagcgtga

DBGET integrated database retrieval system