KEGG   Cellulomonas gilvus: Celgi_2523Help
Entry
Celgi_2523        CDS       T01537                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic anchor subunit-like protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
cga  Cellulomonas gilvus
Pathway
cga00020  Citrate cycle (TCA cycle)
cga00190  Oxidative phosphorylation
cga00650  Butanoate metabolism
cga01100  Metabolic pathways
cga01110  Biosynthesis of secondary metabolites
cga01120  Microbial metabolism in diverse environments
cga01130  Biosynthesis of antibiotics
cga01200  Carbon metabolism
Module
cga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cga_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celgi_2523
   00650 Butanoate metabolism
    Celgi_2523
  Energy metabolism
   00190 Oxidative phosphorylation
    Celgi_2523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS SLC3A2_N
Motif
Other DBs
NCBI-ProteinID: AEI13022
UniProt: F8A2M9
Position
2797433..2797891
Genome map
AA seq 152 aa AA seqDB search
MTTIADPKAPRPPRARPARLTTRGNTELYGWIFMRASGALLLVLIFGHLFVNLVAGDGVK
AIDFGFVAGKWASPLWQVWDLLMLWLAMIHGTNGMRTIVNDYAEKDSTRLVLKGLLYLAF
VVTVVLGTLVIFTFDPCPTDAPLDLLPSFCTA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatcgcggatcccaaggcgccgcgtcccccgcgcgcccgtccggcacggctg
accacgcgcggcaacaccgagctctacggctggatcttcatgcgcgcgtcgggcgcgctg
ctgctcgtcctgatcttcggccacctgttcgtcaacctcgtcgccggtgacggcgtcaag
gccatcgacttcgggttcgtcgccggcaagtgggcctcgccgctgtggcaggtctgggac
ctgctgatgctgtggctcgcgatgatccacggcaccaacggcatgcgcacgatcgtcaac
gactacgccgagaaggacagcacgcgcctggtgctcaagggcctgctgtacctcgcgttc
gtcgtgaccgtggtcctggggacgctcgtgatcttcacgttcgacccgtgccccaccgac
gcgccgctggacctgctgccgtcgttctgcaccgcctga

DBGET integrated database retrieval system