KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0223
Entry
cg0223            CDS       T00244                                 
Name
(GenBank) METABOLITE TRANSPORT PROTEIN
  KO
K06609  MFS transporter, SP family, major inositol transporter
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Brite
KEGG Orthology (KO) [BR:cgb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgb02000]
    cg0223
Transporters [BR:cgb02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    cg0223
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12 TPR_19
Other DBs
NCBI-ProteinID: CAF18749
Position
complement(190701..192176)
AA seq 491 aa
MASTFIQADSPEKSKKLPPLTEGPYRKRLFYVALVATFGGLLFGYDTGVINGALNPMTRE
LGLTAFTEGVVTSSLLFGAAAGAMFFGRISDNWGRRKTIISLAVAFFVGTMICVFAPSFA
VMVVGRVLLGLAVGGASTVVPVYLAELAPFEIRGSLAGRNELMIVVGQLAAFVINAIIGN
VFGHHDGVWRYMLAIAAIPAIALFFGMLRVPESPRWLVERGRIDEARAVLETIRPLERAH
AEVADVEHLAREEHAVSEKSMGLREILSSKWLVRILLVGIGLGVAQQLTGINSIMYYGQV
VLIEAGFSENAALIANVAPGVIAVVGAFIALWMMDRINRRTTLITGYSLTTISHVLIGIA
SVAFPVGDPLRPYVILTLVVVFVGSMQTFLNVATWVMLSELFPLAMRGFAIGISVFFLWI
ANAFLGLFFPTIMEAVGLTGTFFMFAGIGVVALIFIYTQVPETRGRTLEEIDEDVTSGVI
FNKDIRKGKVH
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggctagtaccttcattcaggccgacagccctgaaaaaagtaagaagctgcccccactc
acagaaggtccgtatagaaagcggctattctacgttgcactagttgcgacgtttggtggg
ctgctcttcggatatgacaccggagtaatcaacggtgcactcaacccaatgacacgtgag
ctcggactaaccgcgttcaccgagggtgttgtaacttcttccctgctgtttggtgcagca
gctggtgcgatgtttttcggtcgcatttccgacaactggggtcgccggaaaacaatcatc
tcacttgcagtagctttctttgtcggcaccatgatctgcgtgtttgctccatcttttgca
gtaatggttgtcggacgtgtgcttcttggactcgcagttggtggcgcttccactgttgtc
cctgtctacctggctgaacttgctccttttgaaatccgtggctcactggctggccgtaat
gagttgatgattgttgttggtcagctcgcagcttttgtcatcaatgcgattattggaaat
gtttttggacaccacgatggtgtgtggcgctacatgctggcaattgccgcaatcccagca
attgccctcttctttggaatgctccgagttccagaatccccacgctggcttgttgagcga
ggacgcattgatgaggctcgcgcagttcttgaaaccattcgccctctagaacgtgcccat
gcagaagttgctgatgttgaacacctagcaagagaagagcacgccgtttccgagaagtcc
atgggcttaagggaaattttgtccagcaagtggcttgtgcgcatcctcctggtaggtatc
ggattgggtgtcgcacagcagctgaccggcatcaactccatcatgtactacggccaggtt
gttctcattgaggctggtttctccgagaatgcagctctgatcgccaacgtggcgccagga
gtgatcgcagttgtcggtgcattcatcgcactgtggatgatggatcgtatcaaccgccgt
accaccctcattaccggttattctctcaccaccattagccacgtattgatcggtatcgca
tccgtagcattcccagtcggcgatcctcttcgcccctacgttatcttgactctggttgtg
gtcttcgtgggatccatgcagaccttcctcaacgtagctacctgggttatgctctctgag
ctcttcccgctggcaatgcgcggtttcgcaatcggtatctcagtgttcttcctctggatc
gcaaacgcgttcctcggattgttcttcccaaccatcatggaagcagtaggactaaccgga
accttcttcatgttcgccggaatcggtgtggttgccttgatcttcatctacacccaggtt
cctgaaactcgtggacgtaccttggaggagattgatgaggatgttacttccggtgtcatt
ttcaacaaggacatccgaaaaggaaaggtgcactaa

DBGET integrated database retrieval system