KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0442Help
Entry
cg0442            CDS       T00244                                 

Gene name
galU2
Definition
(GenBank) PUTATIVE UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERA
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00040  Pentose and glucuronate interconversions
cgb00052  Galactose metabolism
cgb00500  Starch and sucrose metabolism
cgb00520  Amino sugar and nucleotide sugar metabolism
cgb01100  Metabolic pathways
cgb01130  Biosynthesis of antibiotics
Module
cgb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    cg0442 (galU2)
   00052 Galactose metabolism
    cg0442 (galU2)
   00500 Starch and sucrose metabolism
    cg0442 (galU2)
   00520 Amino sugar and nucleotide sugar metabolism
    cg0442 (galU2)
Enzymes [BR:cgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     cg0442 (galU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Tom7
Motif
Other DBs
NCBI-ProteinID: CAF19081
Position
389249..390172
Genome map
AA seq 307 aa AA seqDB search
MSLPIAQHQNAVKTVVVPAAGMGTRFLPATKTIPKELLPVVDTPGIELVAKEAADLGATR
LAIITAPNKDGILKHFEEFPELEATLEARGKTDQLNKVRAARELIATVPVVQEKPLGLGH
AVGLAESVLDDDEDVVAVMLPDDLVLPFGVTERMAEVRAKFGGSVLAAIEVAEDEVSNYG
VFKLGELDAESESEGIRRVVGMVEKPAPEDAPSRFAATGRYLLDRAIFDALRRIEPGAGG
ELQLTDAIALLIEEGHPVHIVVHEGKRHDLGNPAGYIPAVVYFGLRHAEYGSKIHRAVKE
ILAEFES
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgccaatagctcagcatcaaaatgctgtaaaaactgtcgtggtaccagctgca
ggaatgggaacacggttccttcctgcaacgaagacaattccaaaggagcttcttcctgta
gttgataccccgggtattgaacttgttgccaaagaggctgctgatcttggtgcaactcgg
ttagcaattatcactgctccgaacaaagacggaattcttaaacacttcgaggagttccct
gagcttgaggcaactcttgaggctcgcggtaagactgatcaactgaataaagttcgagca
gctcgagaattgattgcaacagttccagtggttcaagaaaagccattggggcttggtcac
gctgttggccttgctgagtctgtgctcgatgatgatgaagatgttgtggctgtcatgctg
ccagacgatttggtgctgccatttggtgtgaccgagagaatggcagaagttcgcgctaag
tttggcggatctgttcttgcagcaattgaggtggctgaagatgaagtctcaaattacgga
gtatttaagctcggtgaactcgatgcagagtccgaaagtgaaggcattaggcgtgttgta
ggaatggttgaaaagcctgcgcctgaagatgcaccatcaaggtttgccgcaacgggccgt
tatctacttgatcgagctatttttgatgcactgcgtcgaattgagcctggtgctggtgga
gaactgcaattaacagatgccatcgcattattgatcgaagaaggccatccggtacacatt
gtggttcatgaaggaaagcgccatgaccttggtaatccagctgggtacattcctgctgtt
gtgtacttcggacttcgtcatgcagagtacggttccaagattcaccgtgcggtgaaggaa
atactcgctgagtttgaatcttaa

DBGET integrated database retrieval system