KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0476Help
Entry
cg0476            CDS       T00244                                 

Gene name
murB2
Definition
(GenBank) PROBABLE UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUC
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00520  Amino sugar and nucleotide sugar metabolism
cgb00550  Peptidoglycan biosynthesis
cgb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    cg0476 (murB2)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    cg0476 (murB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cgb01011]
    cg0476 (murB2)
Enzymes [BR:cgb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     cg0476 (murB2)
Peptidoglycan biosynthesis and degradation proteins [BR:cgb01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   cg0476 (murB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MurB_C FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: CAF19112
UniProt: Q8NTB0
Position
419781..420887
Genome map
AA seq 368 aa AA seqDB search
MLDSSLAQEIAAIDGVELDSEVTFADLTTLRIGGKPRSAVRCQTTEALVSAIKLLDDASL
PLLIVGGGSNLVVADGDLDVIAVIIETDDVSINLTDGLLTADAGAVWDDVVHLSVDAGLG
GIECLSGIPGSAGATPVQNVGAYGTEVSDVLTRVQLLDRTTHQVSWVDASELDLSYRYSN
LKFTNRAVVLAIELQLLTDGLSAPLRFGELGRRLAISEAEPHPRRPVRMVRDAVLELRRA
KGMVVEHTDHDTWSAGSFFTNPIVDPALADAVFEKVGEPTMPRFPAGDGKEKLSAAWLIE
RAGFKKGHPGAGAKASLSTKHTLALTNRGDARASDLVALAKEIRDGVLETFGVTLVPEPV
WIGISIDD
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgttggattcatcgctagcccaggaaatcgccgcgatcgacggcgtcgaactcgattcg
gaagtcactttcgccgatctgacgaccctccgcatcggcggaaaaccccgcagcgccgta
cgttgccagaccacggaggcgctggtcagcgccataaaattgcttgacgacgcctccctc
cccctcctcatcgtcggcggcgggtccaatctcgtcgtggccgacggcgatctggatgtt
attgccgtcatcatcgaaaccgacgacgtctccatcaacctcaccgacggtctcctcacc
gccgatgcaggcgctgtttgggacgatgttgtccacctttcggtggatgccggcctcggt
ggaattgaatgcctctccggaatccccggctccgccggcgccaccccagtccaaaacgtg
ggcgcctacggcacggaagtttccgatgtactcacccgcgtccagcttctcgaccgcacc
acccaccaagtctcctgggtcgacgcctccgaactcgacctctcttaccgatactccaat
ctcaaattcaccaaccgcgcagtcgtcttggcgatcgaactccagctcctcaccgacgga
ttgtccgcgccgctacgttttggtgaattgggacgtcgattagcgatctccgaggccgaa
ccccacccacgtcgccccgtccgcatggtccgcgacgccgtcctagaactccgccgcgcc
aaaggcatggtcgtggaacacaccgaccacgacacctggtccgccggatccttcttcacc
aacccaatcgtcgacccagcccttgccgacgcagtctttgaaaaagtcggcgaacccacc
atgccccgcttcccagccggcgatggcaaagaaaaactctccgcagcctggctcatcgaa
cgcgccggcttcaaaaagggacaccccggcgcaggcgcaaaagcctccctgagcaccaaa
cacaccctcgcactcaccaaccgtggcgacgcccgcgcctccgacctcgtcgcattagcc
aaagaaatccgcgacggagtcctcgaaaccttcggcgtcaccctcgtcccagaacccgtc
tggattggaatcagcatcgatgactga

DBGET integrated database retrieval system