KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0497Help
Entry
cg0497            CDS       T00244                                 

Gene name
hemA
Definition
(GenBank) GLUTAMYL-TRNA REDUCTASE
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00860  Porphyrin and chlorophyll metabolism
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cg0497 (hemA)
Enzymes [BR:cgb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     cg0497 (hemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlutR_N Shikimate_DH GlutR_dimer OCD_Mu_crystall Sacchrp_dh_NADP Glu_dehyd_C ApbA DnaJ-X F420_oxidored 3HCDH_N ThiF
Motif
Other DBs
NCBI-ProteinID: CAF19133
UniProt: P0C543
Position
438515..439906
Genome map
AA seq 463 aa AA seqDB search
MSVLIVGMSHRSAPVSLLERLSMDDSVRGETTQALLGRASLSEALIVSTCNRLEVYTVTS
SFHTGVNDVVEVLHEASGVDIETLRGYLYVRYADAAAEHMLVVTSGLDSMVLGEQQIIGQ
VRTAYQAANEYGSVGPALHSLTQTALHTGKRVHSETAIDDAGASMVSFAVDRALVQMGLD
SEAEAPLSGKTALVLGAGAMSSLAATHLGRAGISNLIMANRTLERAERLAEHSLEAGVPA
EVVEYDQRASAYNRVDLVVSATGADDFTVKPEDIPEGASLMLVDLSMPRDIDDACADLPG
VDLVNIERLHKASREGGSGMAPSEEEALAIVREELDSFTSEQRIRDIVPAVSALRRQAAS
VGSDELDRLRQRAPGISEVEWGEVEKTVRRVVDKLLHEPTVRVKELAARSGSISYDSALQ
ELFGLESLASTAAPATTSVNASELPDAGIVAFVNAPSATQTRE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtactcatcgtagggatgtcgcacaggtctgcgcctgtgtcgcttcttgaacgt
ctgagcatggatgattcagtacgtggtgaaacaactcaagcactcctgggtagggcgtct
ttaagcgaggccctcattgtctctacgtgtaaccgcctggaggtctacaccgtcactagc
agtttccatactggtgttaatgatgtggtggaggttctccatgaggcaagtggcgtagat
attgaaactttgcgcggatatctttatgtccgttacgccgatgctgctgctgaacacatg
ttggtggtgacttccgggttggattccatggtgttgggtgagcagcagatcattggtcag
gtgcgcactgcgtaccaagcagctaatgaatatggttctgtcggtcctgctttgcattca
cttacccagaccgcgctgcataccggcaagcgcgtgcattcggagactgctattgatgat
gctggtgcatcgatggtgtctttcgctgtggatcgcgcgttggtgcagatgggtcttgat
tcggaggcagaagccccactatctggcaagacagccttggtgttgggcgctggcgcgatg
agttctcttgcagccactcaccttggtcgcgctggaatttccaacttgatcatggccaac
cgcactctggaacgtgccgaaaggcttgcggagcattccctagaagccggagttcctgca
gaggttgtggaatacgatcagcgagcttccgcctacaatcgcgttgacctggtagtttcc
gccacgggagcggatgatttcaccgtgaagcctgaggatattccagaaggtgcttcgttg
atgttggtggatttgtccatgccacgagacatcgatgatgcttgtgcggatctgccgggc
gttgatttggtgaacatcgaacgcctgcacaaggcctcccgtgagggtggatcgggcatg
gcgccaagcgaggaagaagctttggcgattgttcgggaagagttggattctttcacctct
gagcagcgcattcgcgatatcgttccagctgtgtccgcgttgcgcaggcaggccgcgtcg
gtgggaagcgatgaattggatcgactccgccaacgtgcccccgggatttccgaggtggaa
tggggggaagtggagaaaacagtgagacgggtcgtcgataagcttcttcatgaacccact
gtgcgcgtcaaggaactggcggcccggtccggcagcatctcttatgattcagctctgcaa
gagctgttcggtttggagtcgctggcgagcaccgcagcaccggcaaccacgtccgtcaac
gcgtcagaactgccggatgcgggtatcgtcgcattcgtgaacgcaccttctgccacacaa
acgagggagtaa

DBGET integrated database retrieval system