KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0736
Entry
cg0736            CDS       T00244                                 
Name
(GenBank) ABC-type transporter, ATPase component
  KO
K02071  D-methionine transport system ATP-binding protein
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cgb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    cg0736
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgb02000]
    cg0736
Transporters [BR:cgb02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   D-Methionine transporter
    cg0736
SSDB
Motif
Pfam: ABC_tran NIL SMC_N AAA_21 AAA_22 AAA_29 RsgA_GTPase TniB ABC_ATPase ALS_ss_C AAA_16 MeaB SbcC_Walker_B MMR_HSR1 AAA_30 AAA_18 AAA_23
Other DBs
NCBI-ProteinID: CAF19343
UniProt: Q8NSN2
Position
complement(650572..651654)
AA seq 360 aa
MSHTASTPTPEEYSAQQPSTQGTRVEFRGITKVFSNNKSAKTTALDNVTLTVEPGEVIGI
IGYSGAGKSTLVRLINGLDSPTSGSLLLNGTDIVGMPESKLRKLRSNIGMIFQQFNLFQS
RTAAGNVEYPLEVAKMDKAARKARVQEMLEFVGLGDKGKNYPEQLSGGQKQRVGIARALA
TNPTLLLADEATSALDPETTHEVLELLRKVNRELGITIVVITHEMEVVRSIADKVAVMES
GKVVEYGSVYEVFSNPQTQVAQKFVATALRNTPDQVESEDLLSHEGRLFTIDLTETSGFF
AATARAAEQGAFVNIVHGGVTTLQRQSFGKMTVRLTGNTAAIEEFYQTLTKTTTIKEITR
NT seq 1083 nt   +upstreamnt  +downstreamnt
gtgtcacacaccgcgtccacaccgacgccagaggaatactccgcgcagcaacccagcacc
cagggcactcgcgttgagttccgcggcataaccaaagtctttagcaacaataaatctgct
aaaaccaccgcgcttgataatgtcactctcaccgtagaacccggtgaggtaatcggcatc
atcggttactctggcgccggcaagtccactcttgtccgcctcatcaatggccttgactcc
cccacgagcggttcgttgctgctcaacggcaccgacatcgtcggaatgcccgagtctaag
ctgcgtaaactgcgcagtaatatcggcatgattttccagcagttcaacctgttccagtcg
cgtactgcggctggaaatgtggagtacccgctggaagttgccaagatggacaaggcagct
cgtaaagctcgcgtgcaagaaatgctcgagttcgtcggcctgggcgacaaaggcaaaaac
taccccgagcagctgtcgggcggccagaagcagcgcgtcggcattgcccgtgcactggcc
accaatccaacgcttttgcttgccgacgaagccacctccgctttggacccagaaaccacc
catgaagttctggagctgctgcgcaaggtaaaccgcgaactgggcatcaccatcgttgtg
atcacccacgaaatggaagttgtgcgttccatcgcagacaaggttgctgtgatggaatcc
ggcaaagttgtggaatacggcagcgtctacgaggtgttctccaatccacaaacacaggtt
gctcaaaagttcgtggccaccgcgctgcgtaacaccccagaccaagtggaatcggaagat
ctgcttagccatgagggacgtctgttcaccattgatctgactgaaacgtccggcttcttt
gcagcaaccgctcgtgctgccgaacaaggtgcttttgtcaacatcgttcacggtggcgtg
accaccttgcaacgccaatcatttggcaaaatgactgttcgactcaccggcaacaccgct
gcgattgaagagttctatcaaaccttgaccaagaccacgaccatcaaggagatcacccga
tga

DBGET integrated database retrieval system