KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg1288
Entry
cg1288            CDS       T00244                                 
Name
(GenBank) Permease of the major facilitator superfamily
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_3 PTR2 MFS_1_like LacY_symp BT1
Other DBs
NCBI-ProteinID: CAF19843
Position
1187293..1188510
AA seq 405 aa
MLTQKIELEAKPKIPEEIWVLVVAAFIIALGYGLIAPILPQFVVGFDVSFAAASAVVSIF
AGARLLFAPMSGSLIDKIGSRRVYLTGLLTVAITTGLVALAQEYWQILLLRGIAGIGSTM
FTVSAMGLIVKMAPVEIRGRCSSVYASSFLFGNIIGPVVGAAMSGLGMRWPFAIYGASVG
LAALVVWWRMPKTNDSLRKADSNSVPALRFAEAIKDSAYRSALFSAFANGWSNFGVRVAV
LPLFAAAAFSNGGAIAGFAMAAFAAGNALCLQFAGDLSDRIGRKPMIISGLIVNAVFTAM
IGFGTEVWILITVSALAGAGAGLLNPSQQAVLADVIDSRPGGKVLANFQMAQDFGAIVGP
ILVGMIAEQAGFQIGFMLCGVISLLAAVAWIFGRETLPTAKVEQV
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgttaactcaaaaaatagaattagaggctaaaccaaaaatcccagaggagatctgggtg
ctggttgtggctgcgtttattattgcgctgggctatggcctgattgcgccgattttgcca
cagtttgtggtcggttttgatgtaagttttgcagctgccagtgcggtggtgtccatcttt
gcgggcgcccggttgttgtttgcgccgatgtcggggagtttgatcgataagatcggttcc
cgtcgtgtgtatctcactggtttactcaccgtggctatcaccacggggcttgttgcgttg
gcgcaggaatactggcagattctgctgcttcgtggcatcgcaggtattggttccaccatg
tttacggtctctgccatgggcctgatcgtgaagatggcgccggtggagatccgcgggcgg
tgttcgtcggtatatgccagttcgttcctgtttggcaatattattggcccggttgtgggt
gctgcgatgtccggtttgggcatgcggtggccgttcgcgatttatggtgcttccgttggc
ttagctgcacttgttgtgtggtggcggatgccgaaaaccaacgattcacttcggaaggct
gatagcaatagtgtgccggcgttgcgctttgctgaggcaattaaggattctgcctaccgc
tcggcgttgtttagtgcttttgccaatggttggtcgaactttggtgtgcgtgtggcggtt
cttccactgtttgccgcagctgcatttagcaatggcggagctattgcgggttttgccatg
gctgcgttcgccgctggaaatgctttgtgtctgcaattcgcgggcgatctctcagatcgc
attggccgtaaaccgatgattatttccgggctgatcgtcaatgcagtgttcacggcaatg
atcggattcggcacagaagtgtggatcctgatcacggtatctgcgttggcaggtgctggt
gcgggcttgcttaatccaagtcagcaggcggtgctcgctgatgttatagattcccgcccc
ggcggaaaagtcttagcgaatttccaaatggcgcaggatttcggtgcgattgttggcccg
attctcgtaggcatgatcgcagaacaggcaggcttccaaatcggattcatgctgtgtggt
gtgatcagtttgctggctgcggtcgcatggatcttcggccgggagacgctgccaacggcg
aaagtcgagcaggtataa

DBGET integrated database retrieval system