KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg1434
Entry
cg1434            CDS       T00244                                 

Symbol
yggB
Name
(GenBank) Small-conductance mechanosensitive channel
  KO
K22044  moderate conductance mechanosensitive channel
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Brite
KEGG Orthology (KO) [BR:cgb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgb02000]
    cg1434 (yggB)
Transporters [BR:cgb02000]
 Other transporters
  Pores ion channels [TC:1]
   cg1434 (yggB)
SSDB
Motif
Pfam: MS_channel
Other DBs
NCBI-ProteinID: CAF19973
UniProt: P42531
Position
complement(1337561..1339162)
AA seq 533 aa
MILGVPIQYLLYSLWNWIVDTGFDVAIILVLAFLIPRIGRLAMRIIKRRVESAADADTTK
NQLAFAGVGVYIAQIVAFFMLAVSAMQAFGFSLAGAAIPATIASAAIGLGAQSIVADFLA
GFFILTEKQFGVGDWVRFEGNGIVVEGTVIEITMRATKIRTIAQETVIIPNSTAKVCINN
SNNWSRAVVVIPIPMLGSENITDVIARSEAATRRALGQEKIAPEILGELDVHPATEVTPP
TVVGMPWMVTMRFLVQVTAGNQWLVERAIRTEIISEFWEEYGSATTTSGTLIDSLHVEHE
EPKTSLIDASPQALKEPKPEAAATVASLAASSNDDADNADASVINAGNPEKELDSDVLEQ
ELSSEEPEETAKPDHSLRGFFRTDYYPNRWQKILSFGGRVRMSTSLLLGALLLLSLFKVM
TVEPSENWQNSSGWLSPSTATSTAVTTSETSAPVSTPSMTVPTTVEETPTMESNVETQQE
TSTPATATPQRADTIEPTEEATSQEETTASQTQSPAVEAPTAVQETVAPTSTP
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgattttaggcgtacccattcaatatttgctctattcattgtggaattggattgtcgat
accggttttgatgtagcaattatcctggtcttggcgtttttgattccacgtatcggccga
ctggccatgcgtattatcaagcgccgagtggagtctgcagccgatgcggacaccactaag
aaccagctcgcgttcgccggcgttggcgtttatatcgcgcaaattgtggcgtttttcatg
cttgccgtctccgcgatgcaggcttttggtttctctctcgcgggcgctgcgattccggca
accattgcgtcagctgccattggccttggtgcgcagtcgattgttgcggacttcttggcc
ggatttttcatcctgacggaaaagcaattcggcgtgggtgactgggtgcgttttgagggc
aacggcatcgttgtcgaaggcaccgtcattgagatcaccatgcgcgcgaccaaaattcgc
acgattgcacaagagaccgtgatcatccccaactccacggcgaaagtgtgcatcaacaat
tctaataactggtcgcgtgcggttgtcgttattccgatccccatgttgggttctgaaaac
atcacagatgtcatcgcgcgctctgaagctgcgactcgtcgcgcacttggccaggagaaa
atcgcaccggaaatcctcggtgaactcgatgtgcacccagccacggaagtcacgccgcca
acggtggtcggcatgccgtggatggtcaccatgcgtttcctcgtgcaagtcaccgccggc
aatcaatggctggtcgaacgcgccatccgcacagaaatcatcagcgaattctgggaagaa
tacggcagcgcaaccactacatcgggaaccctcattgattccttacacgttgagcatgaa
gagccaaagacctcgcttatcgacgcctccccccaggctcttaaggaaccgaagccggag
gctgcggcgacggttgcatcgctagctgcatcctctaacgacgatgcagacaatgcagac
gcctcggtgatcaatgcaggcaatccagagaaggaacttgattccgatgtgctggaacaa
gaactctccagcgaagaaccggaagaaacagcaaaaccagatcactctctccgaggcttc
ttccgcactgattactacccaaatcggtggcagaagatcctgtcgtttggcggacgtgtc
cgcatgagcacgtccctgttgttgggtgcgctgctcttgctgtcactatttaaggtcatg
actgtggaaccaagtgagaattggcaaaactccagtggatggctgtcaccaagcactgcc
acctcaactgcggtgaccacctccgaaacttccgcgccagtaagcacgccttcgatgaca
gtgcccactacggtggaggagaccccaacgatggaatctaacgtcgaaacgcagcaggaa
acctcaacccctgcaaccgcaacgccccagcgagccgacaccatcgaaccgaccgaggaa
gccacgtcgcaggaggaaacgactgcgtcgcagacgcagtctccagcagtggaagcacca
accgcggtccaagagacagttgcgccgacgtccaccccttag

DBGET integrated database retrieval system