KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg1785
Entry
cg1785            CDS       T00244                                 

Symbol
amt
Name
(GenBank) high-affinity ammonia permease
  KO
K03320  ammonium transporter, Amt family
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Brite
KEGG Orthology (KO) [BR:cgb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgb02000]
    cg1785 (amt)
Transporters [BR:cgb02000]
 Other transporters
  Pores ion channels [TC:1]
   cg1785 (amt)
SSDB
Motif
Pfam: Ammonium_transp DUF3188
Other DBs
NCBI-ProteinID: CAF21591
UniProt: P54146
Position
complement(1676732..1678090)
AA seq 452 aa
MDPSDLAWILAAFALVSLMFPGLSLLYGGMLGGQHVLNTFMMVMSSLGIISLVYIIYGHG
LVLGNSIGGWGIIGNPLEYFGFRNIMEDDGTGDLMWAGFYILFAAISLALVSSGAAGRMR
FGAWLVFGVLWFTFVYAPLAHWVFAIDDPESGYVGGWMKNVLEFHDFAGGTAVHMNAGAS
GLALAIVLGRRHSMAVRPHNLPLILIGAGLIVAGWFGFNGGTAGGANFLASYVVVTSLIA
AAGGMMGFMLVERVFSGKPTFFGSATGTIAGLVAITPAADAVSPLGAFAVGALGAVVSFW
AISWKKGHRVDDSFDVFAVHGMAGIAGALFVMLFGDPLAPAGVSGVFFGGELSLLWREPL
AIIVTLTYAFGVTWLIATILNKFMTLRITSEAEYEGIDRAEHAESAYHLNSNGIGMATRT
NFGPEIPEETVPDAVQVGVDKQKIADTRKASK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacccctcagatctagcctggattctcgcagcttttgcgttggtaagcctgatgttc
cccggattgtccctgctctacggcggcatgctgggtgggcaacacgttcttaacacgttc
atgatggttatgagctcacttggaatcatcagccttgtgtacatcatttatggacacgga
cttgtcttaggaaactccatcggtgggtggggaattatcggaaatccccttgaatacttc
ggcttccgcaacattatggaagatgacggcaccggagacctcatgtgggccggcttctac
attctgttcgctgcaatctcactcgcacttgtttcatctggtgcagcggggcgcatgcgc
tttggagcgtggctggtcttcggtgtcctgtggttcacctttgtgtacgcgccactggca
cactgggttttcgctatcgatgatcctgagtccggctacgtgggtggctggatgaaaaat
gtgcttgagttccacgactttgctggtggaacggcagtgcacatgaatgcgggtgcgtct
ggactcgcgctggcaatagtgctgggacgccgccactccatggctgtgcgtccacacaac
cttccactgattttgattggtgcaggactgatcgttgcgggctggttcggattcaatggt
ggtaccgcaggtggtgccaacttcctcgcaagctacgtggtcgttacctctctcattgct
gcagctggcggaatgatgggcttcatgctcgttgaacgtgtgttcagcggaaaacccact
ttctttggctcggcaaccggcacaatcgcaggccttgtggctatcaccccggccgcggat
gcagtgagcccgctcggagcattcgccgtcggagcgctcggcgcagttgtctccttctgg
gcaattagctggaagaagggacaccgagtcgatgattccttcgatgtgttcgcagtccac
ggaatggccggcattgcaggtgcactgtttgtcatgctctttggcgatccactagcacca
gcgggagtttccggagtcttcttcggtggcgaactctccctgctgtggagggaaccactg
gccatcatcgtgacccttacatacgcattcggcgtgacctggttgattgccacgatcttg
aacaagttcatgactctgcgcatcacctccgaagccgaatatgaaggcattgaccgcgca
gaacacgcagaatctgcctaccacctcaattccaacggaattgggatggcaacccgcacc
aatttcggacctgaaatccccgaggaaaccgtgcccgacgccgtgcaggtgggcgtcgat
aagcaaaaaatcgctgatactcgaaaggcctcaaaatga

DBGET integrated database retrieval system