KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2137Help
Entry
cg2137            CDS       T00244                                 

Gene name
gluB
Definition
(GenBank) GLUTAMATE SECRETED BINDING PROTEIN
  KO
K10005  glutamate transport system substrate-binding protein
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb02010  ABC transporters
Module
cgb_M00233  Glutamate transport system
Brite
KEGG Orthology (KO) [BR:cgb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    cg2137 (gluB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgb02000]
    cg2137 (gluB)
Transporters [BR:cgb02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate transporter [MD:M00233] [OT]
    cg2137 (gluB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Phosphonate-bd Lig_chan-Glu_bd Transferrin
Motif
Other DBs
NCBI-ProteinID: CAF20292
UniProt: P48242
Position
2030669..2031556
Genome map
AA seq 295 aa AA seqDB search
MSAKRTFTRIGAILGATALAGVTLTACGDSSGGDGFLAAIENGSVNVGTKYDQPGLGLRN
PDNSMSGLDVDVAEYVVNSIADDKGWDHPTIEWRESPSAQRETLIQNGEVDMIAATYSIN
AGRSESVNFGGPYLLTHQALLVRQDDDRIETLEDLDNGLILCSVSGSTPAQKVKDVLPGV
QLQEYDTYSSCVEALSQGNVDALTTDATILFGYSQQYEGDFRVVEMEKDGEPFTDEYYGI
GLKKDDQEGTDAINAALERMYADGTFQRLLTENLGEDSVVVEEGTPGDLSFLDAS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaaagcgtacttttacccgtatcggtgcgattcttggagcaactgcacttgcc
ggagttaccctcaccgcctgtggtgattcaagcggtggcgacggattcctcgcagccatt
gaaaatggttctgtcaatgtcggcaccaaatacgatcagcctggtcttggcctccgcaac
ccagacaactccatgagcggtctcgacgtggatgttgctgaatacgtagtcaactccatc
gctgatgacaagggctgggatcaccccaccatcgaatggcgtgaatccccttctgcgcag
cgtgaaaccctcattcaaaacggtgaggtagacatgatcgcagcaacctactccatcaac
gctggccgttcagagtccgtcaacttcggtggcccatacctgcttacccaccaggctctg
cttgttcgccaagatgacgatcgcattgaaaccctcgaggacttggataacggtttgatc
ctgtgctccgtttccggatccactccagctcagaaggtcaaggatgtcctcccaggcgtt
cagctccaagaatacgacacctactcttcctgtgttgaggcactgtcccagggcaacgtt
gacgccctgaccactgacgccaccatcctcttcggctactcccagcagtacgaaggcgac
ttccgcgttgtggaaatggaaaaggacggcgagccattcaccgacgagtactacggcatt
ggcctgaagaaggatgaccaggaaggcaccgacgctatcaacgccgcacttgagcgcatg
tacgctgacggcaccttccagcgactgctcaccgagaacctcggtgaagactccgtggtt
gttgaagaaggcaccccaggtgacctctccttcctcgacgcaagctag

DBGET integrated database retrieval system