KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2192Help
Entry
cg2192            CDS       T00244                                 

Gene name
mqo
Definition
(GenBank) MALATE:QUINONE OXIDOREDUCTASE OXIDOREDUCTASE
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00020  Citrate cycle (TCA cycle)
cgb00620  Pyruvate metabolism
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01120  Microbial metabolism in diverse environments
cgb01130  Biosynthesis of antibiotics
cgb01200  Carbon metabolism
Module
cgb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cg2192 (mqo)
   00620 Pyruvate metabolism
    cg2192 (mqo)
Enzymes [BR:cgb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     cg2192 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: CAF20342
UniProt: O69282
Position
complement(2083911..2085413)
Genome map
AA seq 500 aa AA seqDB search
MSDSPKNAPRITDEADVVLIGAGIMSSTLGAMLRQLEPSWTQIVFERLDGPAQESSSPWN
NAGTGHSALCELNYTPEVKGKVEIAKAVGINEKFQVSRQFWSHLVEEGVLSDPKEFINPV
PHVSFGQGADQVAYIKARYEALKDHPLFQGMTYADDEATFTEKLPLMAKGRDFSDPVAIS
WIDEGTDINYGAQTKQYLDAAEVEGTEIRYGHEVKSIKADGAKWIVTVKNVHTGDTKTIK
ANFVFVGAGGYALDLLRSAGIPQVKGFAGFPVSGLWLRCTNEELIEQHAAKVYGKASVGA
PPMSVPHLDTRVIEGEKGLLFGPYGGWTPKFLKEGSYLDLFKSIRPDNIPSYLGVAAQEF
DLTKYLVTEVLKDQDKRMDALREYMPEAQNGDWETIVAGQRVQVIKPAGFPKFGSLEFGT
TLINNSEGTIAGLLGASPGASIAPSAMIELLERCFGDRMIEWGDKLKDMIPSYGKKLASE
PALFEQQWARTQKTLKLEEA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattccccgaagaacgcaccgaggattaccgatgaggcagatgtagttctcatt
ggtgccggtatcatgagctccacgctgggtgcaatgctgcgtcagctggagccaagctgg
actcagatcgtcttcgagcgtttggatggaccggcacaagagtcgtcctccccgtggaac
aatgcaggaaccggccactctgctctatgcgagctgaactacaccccagaggttaagggc
aaggttgaaattgccaaggctgtaggaatcaacgagaagttccaggtttcccgtcagttc
tggtctcacctcgttgaagagggagtgctgtctgatcctaaggaattcatcaaccctgtt
cctcacgtatctttcggccagggcgcagatcaggttgcatacatcaaggctcgctacgaa
gctttgaaggatcacccactcttccagggcatgacctacgctgacgatgaagctaccttc
accgagaagctgcctttgatggcaaagggccgtgacttctctgatccagtagcaatctct
tggatcgatgaaggcaccgacatcaactacggtgctcagaccaagcagtacctggatgca
gctgaagttgaaggcactgaaatccgctatggccacgaagtcaagagcatcaaggctgat
ggcgcaaagtggatcgtgaccgtcaagaacgtacacactggcgacaccaagaccatcaag
gcaaacttcgtgttcgtcggcgcaggcggatacgcactggatctgcttcgcagcgcaggc
atcccacaggtcaagggcttcgctggattcccagtatccggcctgtggcttcgttgcacc
aacgaggaactgatcgagcagcacgcagccaaggtatatggcaaggcatctgttggcgct
cctccaatgtctgttcctcaccttgacacccgcgttatcgagggtgaaaagggtctgctc
tttggaccttacggtggctggacccctaagttcttgaaggaaggctcctacctggacctg
ttcaagtccatccgcccagacaacattccttcctaccttggcgttgctgctcaggaattt
gatctgaccaagtaccttgtcactgaagttctcaaggaccaggacaagcgtatggatgct
cttcgcgagtacatgccagaggcacaaaacggcgattgggagaccatcgttgccggacag
cgtgttcaggttattaagcctgcaggattccctaagttcggttccctggaattcggcacc
accttgatcaacaactccgaaggcaccatcgccggattgctcggtgcttcccctggagca
tccatcgcaccttccgcaatgatcgagctgcttgagcgttgcttcggtgaccgcatgatc
gagtggggcgacaagctgaaggacatgatcccttcctacggcaagaagcttgcttccgag
ccagcactgtttgagcagcagtgggcacgcacccagaagaccctgaagcttgaggaagcc
taa

DBGET integrated database retrieval system