KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2261
Entry
cg2261            CDS       T00244                                 

Symbol
amtB
Name
(GenBank) LOW AFFINITY AMMONIUM UPTAKE PROTEIN
  KO
K03320  ammonium transporter, Amt family
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Brite
KEGG Orthology (KO) [BR:cgb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgb02000]
    cg2261 (amtB)
Transporters [BR:cgb02000]
 Other transporters
  Pores ion channels [TC:1]
   cg2261 (amtB)
SSDB
Motif
Pfam: Ammonium_transp
Other DBs
NCBI-ProteinID: CAF20399
Position
complement(2142201..2143517)
AA seq 438 aa
MGADQIAAVSGNSAWMLMSASLVLLMTPALALFYGGMSRQKSVLNMMMMSFGALGVVTVI
YLLWGWSMSYGTQSIAGIFANPFEFFGLKDSIVDADGNYIEGAAGYPNIIDIGFQLTFAV
ISTALISGALAERVKFSTWLIFSGAWVTLVYFPLAHMVWGGGLLGHNVTGFASWLFGSTD
GEANIAPIDFAGGTVVHISAGTAALVLAFIVGKRKTFGKAIARPHNLPMVMLGAALLWFG
WFGFNGGSAFAADGLAGLAWVNTTAATAAAMLGWLATEKFRDGHATSLGAASGVVAGLVA
ITPAAGALTPVTSLILGAIGGILACLGVGLKYRFGFDDSLDVVGVHLVAGLWGTVGVGLL
ATDIGWFSGGGMDGLKLFIVQIVIALVAVVFAGVITALIAFALKATVGWRVDDDVEQQGI
DTHEHAESAYDTTGPEIR
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgggtgcagatcaaattgcagcagtctccggcaattcagcttggatgctgatgtccgcg
tcgctcgtgctgctaatgacaccagcactggcacttttctatggcggcatgtctcgtcaa
aagtccgtgctcaacatgatgatgatgtcctttggagcattgggcgtcgttactgttatt
tacctcttgtggggatggtcgatgtcttatggaacccaatcaatcgcgggaatctttgct
aacccttttgagttcttcggtcttaaagattccatcgttgatgcagacggcaactacatt
gagggcgcagctggctacccaaacattattgatatcggattccagcttaccttcgccgtt
atctccactgcactgatctccggtgcgttggcagagcgtgtgaagttttccacctggctt
attttcagcggcgcgtgggtgactttggtgtacttcccactggcacacatggtgtggggt
ggcggattgttgggccataatgtcactggttttgcttcgtggttgtttggttctaccgat
ggtgaagccaatatcgctccgatcgactttgctggtggtaccgttgttcacatttcggcg
ggcacagcggcccttgtgctggcttttatcgtcggcaagcgaaagacgtttggcaaggca
attgccaggccgcacaacctgcccatggtcatgctcggcgctgcgctgttgtggtttggt
tggttcgggttcaacggtggctcggcgttcgcagccgacggccttgcgggcctggcctgg
gtgaacaccacggcggcaaccgcagctgcgatgcttggctggttggctactgaaaaattc
cgcgatggacacgcaacctccttgggtgctgcttctggtgtcgtcgccggtctggtcgca
attactccagcagctggcgcactgaccccagtgacctccctgatcctcggtgcaatcggc
ggcatcttggcgtgcttgggcgtggggctgaagtaccgcttcggtttcgatgactccctc
gacgtagttggtgtgcacctggtcgctggcctgtggggcaccgtgggtgtaggacttctt
gccactgacatcggatggtttagtggtggtggcatggatggacttaaactctttattgtc
cagatcgtcatcgcgctagtcgctgtagttttcgcaggtgtgattactgcgctcatcgca
ttcgccctgaaggccacagtaggatggcgcgttgatgatgatgtggagcagcaaggcatt
gatactcacgaacacgcagaatccgcttatgacaccacgggtccggaaattcgttaa

DBGET integrated database retrieval system