KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2399Help
Entry
cg2399            CDS       T00244                                 

Gene name
glk
Definition
(GenBank) GLUCOKINASE, TRANSCRIPTIONAL REGULATOR
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00010  Glycolysis / Gluconeogenesis
cgb00052  Galactose metabolism
cgb00500  Starch and sucrose metabolism
cgb00520  Amino sugar and nucleotide sugar metabolism
cgb00521  Streptomycin biosynthesis
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01120  Microbial metabolism in diverse environments
cgb01130  Biosynthesis of antibiotics
cgb01200  Carbon metabolism
Module
cgb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cg2399 (glk)
   00052 Galactose metabolism
    cg2399 (glk)
   00500 Starch and sucrose metabolism
    cg2399 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    cg2399 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    cg2399 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    cg2399 (glk)
Enzymes [BR:cgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     cg2399 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N TCR BcrAD_BadFG Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: CAF20526
Position
complement(2288251..2289222)
Genome map
AA seq 323 aa AA seqDB search
MPQKPASFAVGFDIGGTNMRAGLVDESGRIVTSLSAPSPRTTQAMEQGIFDLVEQLKAEY
PVGAVGLAVAGFLDPECEVVRFAPHLPWRDEPVREKLENLLGLPVRLEHDANSAAWGEHR
FGAAQGADNWVLLALGTGIGAALIEKGEIYRGAYGTAPEFGHLRVVRGGRACACGKEGCL
ERYCSGTALVYTARELASHGSFRNSGLFDKIKADPNSINGKTITAAARQEDPLALAVLED
FSEWLGETLAIIADVLDPGMIIIGGGLSNAADLYLDRSVNHYSTRIVGAGYRPLARVATA
QLGADAGMIGVADLARRSVVEAN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccacaaaaaccggccagtttcgcggtgggctttgacatcggcggcaccaacatgcga
gccgggcttgtcgacgaatccgggcgcatcgtgaccagtttgtcggcgccgtcgccgcgc
acgacgcaggcaatggaacaggggatttttgatctagtcgaacagctcaaggccgaatac
ccggttggtgctgtgggacttgccgtcgcgggatttttggatcctgagtgcgaggttgtt
cgatttgccccgcaccttccttggcgcgatgagccagtgcgtgaaaagttggaaaacctt
ttgggcctgcctgttcgtttggaacatgatgccaactcagcagcgtggggtgagcatcgt
tttggtgcagctcaaggcgctgacaactgggttttgttggcactcggcactggaattggt
gcagcgctgattgaaaaaggcgaaatttaccgtggtgcatatggcacggcaccagaattt
ggtcatttgcgtgttgttcgtggcggacgcgcatgtgcgtgtggcaaagaaggctgcctg
gagcgttactgttccggtactgccttggtttacactgcgcgtgaattggcttcgcatggc
tcattccgcaacagcgggctgtttgacaagatcaaagccgatccgaattccatcaatgga
aaaacgatcactgcggcagcgcgccaagaagacccacttgctctcgccgttctggaagat
ttcagcgagtggctgggcgaaactttggcgatcattgctgatgtccttgacccaggcatg
atcatcattggtggcggactgtccaatgctgccgacctttatttggatcgctcggtcaac
cactattccacccgcatcgtcggcgcaggatatcgccctttggcacgcgttgccacagct
cagttgggtgcggatgctggcatgatcggtgtcgctgatctagctcgacgctctgtagtg
gaagccaactag

DBGET integrated database retrieval system