KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2587Help
Entry
cg2587            CDS       T00244                                 

Definition
(GenBank) Phosphoglycerate dehydrogenase or related dehydrogenase
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C AdoHcyase_NAD Pyr_redox IlvN ThiF 2-Hacid_dh Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: CAF21020
UniProt: P0C1E8
Position
complement(2467370..2468284)
Genome map
AA seq 304 aa AA seqDB search
MKFVMYPHLWESTTAVIEGGGHERVEDIKDADFIFFNGSAPEFPDLPENIKFVQASMAGI
DALVKRGVVNEKARWANAAGLYADTVAESTIGLILAQMHMHATTRLAKSWSVRPEVENNK
SWLHDNKTVAILGAGGIGVRLLEMLKPFNVKTIAVNNSGRPVEGADETFAMDKAEHVWAE
ADVFVLILPLTDATYQIVNAETLGKMKPSAVVVNVGRGPLINTDDLVDALNNGTIAGAAL
DVTDPEPLPDSHPLWEMDNVVITPHTANTNERIRALTGELTLRNIELFEAGEQMATEVDV
VAGY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgttatgtatccgcatttgtgggagtccacgaccgctgtcattgagggtggc
ggacatgagcgggttgaggatattaaagatgcagacttcattttctttaatggttcagcg
ccggagttcccggatttgccggagaacatcaagttcgtgcaggcctccatggcgggtatt
gatgcgctggtcaagcgtggtgtcgtcaatgagaaggcacgttgggcaaacgcggctggc
ctgtacgctgacaccgttgctgagtccaccattggtttaattctggcgcagatgcacatg
catgcgacgactcgtttggctaagtcgtggagcgtgcggcctgaggtggaaaacaacaag
tcatggctgcatgacaataaaactgtcgctattttgggcgccggtggcattggcgtgcgt
ctgctggaaatgctcaagccgttcaacgtgaagaccattgcggttaataactctggtcgt
ccggtggaaggtgcagatgaaaccttcgccatggataaggctgagcacgtgtgggctgag
gctgatgtgtttgtgctcatcctgccgctgactgatgccacttatcagatcgtcaatgca
gaaactttgggcaagatgaagccttctgccgtggtggtcaatgtggggcgtggcccgctg
atcaacaccgatgatctggtggatgcattgaacaacggcaccattgcgggtgctgcgctg
gacgttaccgatcctgagccacttcctgacagccacccgctgtgggagatggacaatgtg
gttatcactcctcatactgcaaacacgaatgagaggattcgtgctttgaccggcgaactc
accttgcgcaacattgagttgtttgaggcaggcgagcagatggccaccgaggtcgatgtg
gtggctggctactag

DBGET integrated database retrieval system