KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2618
Entry
cg2618            CDS       T00244                                 
Symbol
vanK
Name
(GenBank) VANILLATE TRANSPORTER VANK
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_4 DUF6750 PSI_PsaH
Other DBs
NCBI-ProteinID: CAF21050
Position
2498898..2500238
AA seq 446 aa
MDIRQTINDTAMSRYQWFIVFIAVLLNALDGFDVLAMSFTANAVTEEFGLSGSQLGVLLS
SALFGMTAGSLLFGPIGDRFGRKNALMIALLFNVVGLVLSATAQSAGQLGVWRLITGIGI
GGILACITVVISEFSNNKNRGMAMSIYAAGYGIGASLGGFGAAQLIPTFGWRSVFAAGAI
ATGIATIATFFFLPESVDWLSTRRPAGARDKINYIARRLGKVGTFELPGEQSLSTKKAGL
QSYAVLVNKENRGTSIKLWVAFGIVMFGFYFANTWTPKLLVETGMSEQQGIIGGLMLSMG
GAFGSLLYGFLTTKFSSRNTLMTFMVLSGLTLILFISSTSVPSIAFASGVVVGMLINGCV
AGLYTLSPQLYSAEVRTTGVGAAIGMGRVGAISAPLLVGGLLDSGWSPTQLYVGVAVIVI
AGATALIGMRTQAVAVEKQPEALATK
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggatatccgccaaacaattaacgacacagcaatgtcgagatatcagtggttcattgta
tttatcgcagtgctgctcaacgcactggacggctttgatgtcctcgccatgtcttttact
gcgaatgcagtgaccgaagaatttggactgagtggcagccagcttggtgtgctgctgagt
tccgcgctgttcggcatgaccgctggatctttgctgttcggtccgatcggtgaccgtttc
ggccgtaagaatgccctgatgatcgcgctgctgttcaacgtggtgggattggtattgtcc
gccaccgcgcagtccgcaggccagttgggcgtgtggcgtttgatcactggtatcggcatc
ggcggaatcctcgcctgcatcacagtggtgatcagtgagttctccaacaacaaaaaccgc
ggcatggccatgtccatctacgctgctggttacggcatcggcgcgtccttgggcggtttc
ggcgcagcgcagctcatcccaacatttggatggcgctccgtgttcgcagccggtgcgatc
gcaactggtatcgccaccatcgctactttcttcttcctgccagaatccgttgattggctg
agcactcgccgccctgcgggcgctcgcgacaagatcaattacattgcgcgccgcctgggc
aaagtcggtacctttgagcttccaggcgaacaaagcttgtcgacgaaaaaagccggtctc
caatcgtatgcagtgctcgttaacaaagagaaccgtggaaccagcatcaagctgtgggtt
gcgttcggcatcgtgatgttcggcttctacttcgccaacacttggaccccgaagctgctc
gtggaaaccggaatgtcagaacagcagggcatcatcggtggtttgatgttgtccatgggt
ggagcattcggctccctgctctacggtttcctcaccaccaagttcagctcccgaaacaca
ctgatgaccttcatggtgctgtccggcctgacgctgatcctgttcatttcctccacctct
gttccatccatcgcgtttgccagcggcgttgtcgtgggcatgctgatcaatggttgtgtg
gctggtctgtacaccctgtccccacagctgtactccgctgaagtacgcaccactggtgtg
ggcgctgcgattggtatgggtcgtgtcggtgcgatttccgcgccactgctggtgggtggc
ctgctggattctggctggtccccaacgcagctgtatgttggtgtggcagtgattgttatt
gccggtgcaaccgcattgattgggatgcgcactcaggcggtagccgtcgaaaagcagcct
gaagccctagcgaccaaatag

DBGET integrated database retrieval system