KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2625Help
Entry
cg2625            CDS       T00244                                 

Gene name
pcaF
Definition
(GenBank) PUTATIVE ACETYL-COA:ACETYLTRANSFERASE
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00071  Fatty acid degradation
cgb00072  Synthesis and degradation of ketone bodies
cgb00280  Valine, leucine and isoleucine degradation
cgb00310  Lysine degradation
cgb00362  Benzoate degradation
cgb00380  Tryptophan metabolism
cgb00620  Pyruvate metabolism
cgb00630  Glyoxylate and dicarboxylate metabolism
cgb00640  Propanoate metabolism
cgb00650  Butanoate metabolism
cgb00900  Terpenoid backbone biosynthesis
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01120  Microbial metabolism in diverse environments
cgb01130  Biosynthesis of antibiotics
cgb01200  Carbon metabolism
cgb01212  Fatty acid metabolism
cgb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cgb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    cg2625 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    cg2625 (pcaF)
   00640 Propanoate metabolism
    cg2625 (pcaF)
   00650 Butanoate metabolism
    cg2625 (pcaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    cg2625 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    cg2625 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cg2625 (pcaF)
   00310 Lysine degradation
    cg2625 (pcaF)
   00380 Tryptophan metabolism
    cg2625 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    cg2625 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cg2625 (pcaF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    cg2625 (pcaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgb04147]
    cg2625 (pcaF)
Enzymes [BR:cgb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     cg2625 (pcaF)
Exosome [BR:cgb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   cg2625 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAF21057
Position
2505877..2507103
Genome map
AA seq 408 aa AA seqDB search
MNPQDIVICSPLRTPVGAYGGSFTGVPVEELATTVINAIVEATGITGDDVDDLILGQASP
NGAAPALGRVVALDSKLGQNVPGMQLDRRCGSGLQAIVTAAAHVASGAADLIIAGGAESM
SRVEYTVSGDIRWGVKGGDMQLRDRLAEARETAGGRNHPIPGGMIETAENLRREYGISRE
EQDKISAASQQRWGKAADAGLFDDEIVPVTVPAKKRGQEPTIVSRDEHGRPGTTVEKLAA
LRPIMGRQDAEATVTAGNASGQNDGAAAVIVTTRAKAEEKGLRPVMRLAGWSVAAVPPET
MGIGPVPATKKVLDRLGLTLEDIGAIELNEAFAAQALSVLKEWNISWEDERVNPLGSGIS
MGHPVGATGARMAVTLAHRMQRENTQYGLATMCIGGGQGLAAVFEKEN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctcaagatattgtcatctgttccccattgcgcaccccagttggtgcttacggc
ggatccttcaccggcgtccctgttgaagaattggccaccaccgtgatcaacgcgatcgtt
gaggcaaccggcatcaccggcgacgatgtggacgatctgatcctcggccaggcatccccc
aacggtgcggctccagcactgggccgtgttgttgctctagattccaagcttggccaaaac
gttccaggcatgcagcttgatcgccgctgtggttccggcctgcaggcaatcgtcaccgct
gctgcacacgttgcatccggcgctgctgatctgatcatcgcaggtggcgcagaatccatg
agccgcgttgagtacaccgtgtccggcgatatccgttggggtgtcaagggcggcgacatg
cagcttcgtgaccgccttgcagaagcacgcgaaaccgctggcggacgcaaccacccgatc
cctggtggcatgatcgagaccgctgagaacctgcgtcgcgaatacggcatctcccgcgag
gagcaggacaagatctccgcagcgtcccagcagcgttggggcaaggctgctgatgcgggg
cttttcgacgacgagatcgtgccagtcaccgtccctgccaagaagcgcggccaggagcca
accatcgtttctcgagacgagcatggtcgaccaggaacaaccgtcgaaaagcttgctgct
ttgcgccccatcatgggccgccaggatgcggaagcaaccgtcaccgctggcaacgcgtcc
ggccaaaatgatggcgctgctgccgtcatcgtgaccactcgcgccaaggccgaggagaag
ggcctgcgcccagtcatgcgtttggctggctggtctgtggctgctgttcccccagagacc
atgggtattggacctgttcctgccaccaagaaggtcctggatcgtttgggccttaccctg
gaggacatcggcgcgatcgaactcaacgaagctttcgcagctcaggcactgtctgtgctg
aaggaatggaacatttcttgggaagatgagcgcgtcaacccactgggttccggtatttcc
atgggacacccagtcggtgccaccggtgctcgcatggcagtaaccttggctcaccgcatg
cagcgtgaaaacactcagtacggactggccaccatgtgcatcggtggcggccagggtctt
gcagctgtctttgaaaaggagaactaa

DBGET integrated database retrieval system