KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2925
Entry
cg2925            CDS       T00244                                 
Symbol
ptsS
Name
(GenBank) ENZYME II SUCROSE PROTEIN
  KO
K02810  sucrose PTS system EIIBCA or EIIBC component [EC:2.7.1.211]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00500  Starch and sucrose metabolism
cgb02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:cgb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    cg2925 (ptsS)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    cg2925 (ptsS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgb02000]
    cg2925 (ptsS)
Enzymes [BR:cgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.211  protein-Npi-phosphohistidine---sucrose phosphotransferase
     cg2925 (ptsS)
Transporters [BR:cgb02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sucrose-specific II component
    cg2925 (ptsS)
SSDB
Motif
Pfam: PTS_EIIC PTS_EIIA_1 PTS_EIIB TAXi_C Biotin_lipoyl_2
Other DBs
NCBI-ProteinID: CAF21304
Position
complement(2783130..2785115)
AA seq 661 aa
MDHKDLAQRILRDIGGEDNIVAAAHCATRLRLVLKDTKDVDRQSLDDDPDLKGTFETGGM
FQIIVGPGDVDHVFKELDDATSKDIAVSTEQLKDVVANNANWFSRAVKVLADIFVPLIPI
LVGGGLLMAINNVLVAQDLFGPQSLVEMFPQISGVAEMINLMASAPFAFLPVLVGFTATK
RFGGNEFLGAGIGMAMVFPSLVNGYDVAATMAAGEMPMWSLFGLDVAQAGYQGTVLPVLV
VSWILATIEKFLHKRLKGTADFLITPVLTLLLTGFLTFIAIGPAMRWVGDVLAHGLQGLY
DFGGPVGGLLFGLVYSPIVITGLHQSFPPIELELFNQGGSFIFATASMANIAQGAACLAV
FFLAKSEKLKGLAGASGVSAVLGITEPAIFGVNLRLRWPFFIGIGTAAIGGALIALFNIK
AVALGAAGFLGVVSIDAPDMVMFLVCAVVTFFIAFGAAIAYGLYLVRRNGSIDPDATAAP
VPAGTTKAEAEAPAEFSNDSTIIQAPLTGEAIALSSVSDAMFASGKLGSGVAIVPTKGQL
VSPVSGKIVVAFPSGHAFAVRTKAEDGSNVDILMHIGFDTVNLNGTHFNPLKKQGDEVKA
GELLCEFDIDAIKAAGYEVTTPIVVSNYKKTGPVNTYGLGEIEAGANLLNVAKKEAVPAT
P
NT seq 1986 nt   +upstreamnt  +downstreamnt
atggaccataaggacctcgcgcaacgcatcctgcgcgacattggcggcgaagacaacatt
gtcgccgccgcacactgtgcaacgcgtttacgcctcgtgctcaaagacaccaaggatgtg
gatcgccaaagtctggatgatgatccagatctgaaaggcacgtttgaaacgggtggtatg
ttccagatcatcgtcgggccaggcgatgtggatcatgttttcaaagaactcgatgacgca
acctccaaagacatcgctgtgtccacagagcagctcaaagatgttgtggctaacaacgcc
aactggttcagccgtgctgtgaaggtattggcggacattttcgtcccgctgattccaatc
ttggttggtggcggtctgctcatggctatcaacaatgtgttggttgcgcaggatctgttc
ggtccgcaatcactggtggagatgttccctcagatcagcggtgttgctgagatgatcaac
ctcatggcatctgcgccgttcgcgttcttgccagtgttggttggtttcaccgcaaccaag
cgtttcggcggcaatgagttcctgggcgccggtattggtatggcgatggtgttcccgagc
ttggtgaacggctacgacgtggccgccaccatggctgcgggcgaaatgccaatgtggtcc
ctgtttggtttagatgttgcccaagccggttaccagggcaccgtgcttcctgtgctggtg
gtttcttggattctggcaacgatcgagaagttcctgcacaagcgactcaagggcactgca
gacttcctgatcactccagtgctgacgttgctgctcaccggattccttacattcatcgcc
attggcccagcaatgcgctgggtgggcgatgtgctggcacacggtctacagggactttat
gatttcggtggtccagtcggcggtctgctcttcggtctggtctactcaccaatcgtcatc
actggtctgcaccagtccttcccgccaattgagctggagctgtttaaccagggtggatcc
ttcatcttcgcaacggcatctatggctaatatcgcccagggtgcggcatgtttggcagtg
ttcttcctggcgaagagtgaaaagctcaagggccttgcaggtgcttcaggtgtctccgct
gttcttggtattacggagcctgcgatcttcggtgtgaaccttcgcctgcgctggccgttc
ttcatcggtatcggtaccgcagctatcggtggcgctttgattgcactctttaatatcaag
gcagttgcgttgggcgctgcaggtttcttgggtgttgtttctattgatgctccagatatg
gtcatgttcttggtgtgtgcagttgttaccttcttcatcgcattcggcgcagcgattgct
tatggcctttacttggttcgccgcaacggcagcattgatccagatgcaaccgctgctcca
gtgcctgcaggaacgaccaaagccgaagcagaagcacccgcagaattttcaaacgattcc
accatcatccaggcacctttgaccggtgaagctattgcactgagcagcgtcagcgatgcc
atgtttgccagcggaaagcttggctcgggcgttgccatcgtcccaaccaaggggcagtta
gtttctccggtgagtggaaagattgtggtggcattcccatctggccatgctttcgcagtt
cgcaccaaggctgaggatggttccaatgtggatatcttgatgcacattggtttcgacaca
gtaaacctcaacggcacgcactttaacccgctgaagaagcagggcgatgaagtcaaagca
ggggagctgctgtgtgaattcgatattgatgccattaaggctgcaggttatgaggtaacc
acgccgattgttgtttcgaattacaagaaaaccggacctgtaaacacttacggtttgggc
gaaattgaagcgggagccaacctgctcaacgtcgcaaagaaagaagcggtgccagcaaca
ccataa

DBGET integrated database retrieval system