KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg3362Help
Entry
cg3362            CDS       T00244                                 

Gene name
trpCF
Definition
(GenBank) INDOLE-3-GGLYCEROL-PHOSPHATE SYNTHASE/PHOSPHORIBOSYLANTHRANILATE ISOMERASE
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01130  Biosynthesis of antibiotics
cgb01230  Biosynthesis of amino acids
Module
cgb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cg3362 (trpCF)
Enzymes [BR:cgb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     cg3362 (trpCF)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     cg3362 (trpCF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: CAF18973
UniProt: P06560
Position
3209949..3211373
Genome map
AA seq 474 aa AA seqDB search
MTSNNLPTVLESIVEGRRGHLEEIRARIAHVDVDALPKSTRSLFDSLNQGRGGARFIMEC
KSASPSLGMIREHYQPGEIARVYSRYASGISVLCEPDRFGGDYDHLATVAATSHLPVLCK
DFIIDPVQVHAARYFGADAILLMLSVLDDEEYAALAAEAARFDLDILTEVIDEEEVARAI
KLGAKIFGVNHRNLHDLSIDLDRSRRLSKLIPADAVLVSESGVRDTETVRQLGGHSNAFL
VGSQLTSQENVDLAARELVYGPNKVCGLTSPSAAQTARAAGAVYGGLIFEEASPRNVSRE
TLQKIIAAEPNLRYVAVSRRTSGYKDLLVDGIFAVQIHAPLQDSVEAEKALIAAVREEVG
PQVQVWRAISMSSPLGAEVAAAVEGDVDKLILDAHEGGSGEVFDWATVPAAVKAKSLLAG
GISPDNAAQALAVGCAGLDINSGVEYPAGAGTWAGAKDAGALLKIFATISTFHY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgactagtaataatctgcccacagtgttggaaagcatcgtcgagggtcgtcgcggacac
ctggaggaaattcgcgctcgcatcgctcacgtggatgtggatgcgcttccaaaatccacc
cgttctctgtttgattccctcaaccagggtaggggaggggcgcgtttcatcatggagtgc
aagtccgcatcgccttctttgggaatgattcgtgagcactaccagccgggtgaaatcgct
cgcgtgtactctcgctacgccagcggcatttccgtgctgtgcgagccggatcgttttggt
ggcgattacgatcacctcgctaccgttgccgctacctctcatcttccggtgctgtgcaaa
gacttcatcattgatcctgtccaggtacacgcggcgcgttactttggtgctgatgccatc
ctgctcatgctctctgtgcttgatgatgaagagtacgcagcactcgctgccgaggctgcg
cgttttgatctggatatcctcaccgaggttattgatgaggaggaagtcgcccgcgccatc
aagctgggtgcgaagatctttggcgtcaaccaccgcaacctgcatgatctgtccattgat
ttggatcgttcacgtcgcctgtccaagctcattccagcagatgccgtgctcgtgtctgag
tctggcgtgcgcgataccgaaaccgtccgccagctaggtgggcactccaatgcattcctc
gttggctcccagctgaccagccaggaaaacgtcgatctggcagcccgcgaattagtctac
ggccccaacaaagtctgcggactcacctcaccaagtgcagcacaaaccgctcgcgcagcg
ggtgcggtctacggcgggctcatcttcgaagaggcatcgccacgcaatgtttcacgtgaa
acattgcaaaaaatcatcgccgcagagcccaacctgcgctacgtcgcggtcagccgtcgc
acctccgggtacaaggatttgcttgtcgacggcatcttcgccgtacaaatccacgcccca
ctgcaggacagcgtcgaagcagaaaaggcattgatcgccgccgttcgtgaagaggttgga
ccgcaggtccaggtctggcgcgcgatctcgatgtccagccccttgggggctgaagtggca
gctgcggtggagggtgacgtcgataagctaattcttgatgcccatgaaggtggcagcggg
gaagtattcgactgggctacggtgccggccgctgtgaaggcaaagtctttgctcgcggga
ggcatctctccggacaacgctgcgcaggcactcgctgtgggctgcgcaggtttggacatc
aactctggcgtggaataccccgccggtgcaggcacgtgggctggggcgaaagacgccggc
gcgctgctgaaaattttcgcgaccatctccacattccattactaa

DBGET integrated database retrieval system