KEGG   Cyanobium gracile: Cyagr_1908Help
Entry
Cyagr_1908        CDS       T02359                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cgc  Cyanobium gracile
Pathway
cgc00010  Glycolysis / Gluconeogenesis
cgc00071  Fatty acid degradation
cgc00350  Tyrosine metabolism
cgc00625  Chloroalkane and chloroalkene degradation
cgc00626  Naphthalene degradation
cgc01100  Metabolic pathways
cgc01110  Biosynthesis of secondary metabolites
cgc01120  Microbial metabolism in diverse environments
cgc01130  Biosynthesis of antibiotics
cgc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyagr_1908
  Lipid metabolism
   00071 Fatty acid degradation
    Cyagr_1908
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cyagr_1908
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cyagr_1908
   00626 Naphthalene degradation
    Cyagr_1908
Enzymes [BR:cgc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cyagr_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AFY29042
UniProt: K9P6L8
Position
1855669..1856769
Genome map
AA seq 366 aa AA seqDB search
MLRTRAGTLRRSAGEADMKAMVIEACCDMALTPAPLVPMDLPPPVPGPGELLVKVEVCGV
CHTELDEIEGRTPPPRFPVIPGHQIVGTVAASDPGCEGLAPGDAVGIAWIFHACGSCAFC
RSGRENLCPAFVATGRDVNGGYAEYVTVPAAFAHRLPAGLEAASVAPMLCAGAIGYRSLE
LSGLADGQDMGLTGFGASAHLVLPMVRHRFPASRVFVFARSAVQRAFALELGAAWAGATE
AESPVKLHAVIDTTPAWTPVVAALRNLHPGGRLVINAIGKQEADKAALLNLDYSRDLWRE
KEIRSVANVTRADVREFLALAAAAGIRAEVKEFPLAEANQALQELRRGQGRGAKVLRIGS
AGAAGI
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaacgcgcgccgggacactgcgccggtccgccggggaggccgacatgaaggcg
atggtgatcgaggcctgctgcgacatggcgctcacaccggccccgctggtgccgatggac
ctgccgccgcccgtgccggggcccggcgagctgctggtgaaggtggaggtgtgcggggtg
tgccacaccgaactcgatgagatcgagggacgcacccctccaccccgctttccggtgatc
ccgggccatcagatcgtcggcaccgtggccgccagcgaccccggctgcgaaggcttagct
ccgggcgacgcggtgggcatcgcctggatcttccacgcctgcggcagctgcgcgttctgc
cgcagcggccgggagaacctctgcccggcgttcgtggccaccggccgggacgtcaacggc
ggctacgcagagtacgtgaccgtgccggcagcgttcgcccatcgcctgccggcggggctg
gaggccgcgtcggtggcacccatgctctgcgccggggcgatcgggtaccgctcgctcgaa
ctctccggcctggccgatgggcaggacatggggctcaccggcttcggggcgtcggcccac
ctggtgctgccgatggtgcgccaccgctttccggcctcgcgggtgttcgtgttcgcccgc
agcgccgtccagcgggccttcgccctggaactgggggccgcctgggccggggccaccgaa
gccgaatcccccgtgaagctgcacgccgtgatcgacaccaccccggcctggacacccgtt
gtggccgccctgaggaacctgcaccccggcggccggctggtgatcaacgccatcggcaag
caggaggctgacaaggcggccctgctgaacctcgactactcccgcgatctctggcgcgag
aaggagatccgctcggtggccaacgtgacccgcgccgacgtgcgggagttcctggccttg
gcggccgccgccgggatccgcgctgaggtgaaggagttccccctggccgaggcgaaccag
gccctgcaggagctgcgccgcggccaggggcggggggccaaggtgctgcggatcggatcg
gccggcgctgccgggatctga

DBGET integrated database retrieval system