KEGG   Cyanobium gracile: Cyagr_2591Help
Entry
Cyagr_2591        CDS       T02359                                 

Definition
(GenBank) pterin-4a-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
cgc  Cyanobium gracile
Pathway
cgc00790  Folate biosynthesis
cgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyagr_2591
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgc04147]
    Cyagr_2591
Enzymes [BR:cgc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Cyagr_2591
Exosome [BR:cgc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cyagr_2591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AFY29695
UniProt: K9P993
Position
complement(2514787..2515128)
Genome map
AA seq 113 aa AA seqDB search
MNLRDELCIPAQGVGPPLTSDEINRFLGELPGWELVEGNHLHKVWTFQDFSSALHWVRHA
GAICEEQGHHADFQLGWGYAAATTYTHDPEGLTRSDVVLAAKFDAISDGDDLA
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacgggacgaactctgcatccctgcccaaggtgttggccccccattgaccagc
gatgaaatcaacaggttcctgggcgaactgcctggctgggagctggtcgaaggaaatcat
ctgcacaaggtctggacgttccaggatttcagctccgcactccactgggtgcgccatgcc
ggagccatctgtgaggagcaggggcaccatgccgatttccagctgggatggggatatgcg
gccgccaccacttacacccacgatccagaaggactgacccgctccgatgtggtgctggca
gcgaagttcgatgccatcagtgacggtgacgacctcgcctga

DBGET integrated database retrieval system