KEGG   Cyanobium gracile: Cyagr_2678Help
Entry
Cyagr_2678        CDS       T02359                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cgc  Cyanobium gracile
Brite
KEGG Orthology (KO) [BR:cgc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Cyagr_2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 PsbH
Motif
Other DBs
NCBI-ProteinID: AFY29770
UniProt: K9P9G7
Position
2587899..2588627
Genome map
AA seq 242 aa AA seqDB search
MLLYKLLVEWIRLSQPHLLSLDRNTRTGLILAGIFGSYAIGANGIGNVMGFFVEASPFRD
LTVGRFSVSSVEQLFLIGAIAVAVGVYTYSRRVMMTVGDGLLALSPLAAFVVVVSHSLVL
FLFSSTALESLLASLGLPTIPLLPVSGSQAVVGSVLGIGLLQGLKGVRQIRWGVLGGIAS
GWVTTPLIAAVIGFVLLFVVQNVFGQEVFLPHDPGLTPSAIESSSGAALLPVAGMTSGLT
PP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgctgctttacaagctgctggtggagtggatccgcctcagtcagccccacctgctctcc
ctcgatcgcaacacccgcaccggtctgatcctggcgggcatcttcggctcctatgcgatc
ggcgccaacggcatcggcaacgtgatgggcttcttcgtggaggcctcacccttccgtgac
ctcaccgttggacgcttcagtgtttcgtcagtggagcagctgtttctgatcggcgccatc
gccgtggccgtgggcgtgtatacctactcacgacgcgtgatgatgactgtgggcgacggc
ctgttggccctctcgccgctggctgccttcgtggtggtcgtgtcccattcgttagtgctg
ttcctcttctcctccacggcgctggagagcctgctggcgagcctgggcctgccaacgatt
ccgctgttgccagtgtcgggatcgcaggcagtggtcggttcggtgctcggcatcggcctg
ctgcagggtctcaagggggtgcgccagattcgctggggggttcttggagggatcgcctcc
ggctgggtcaccacgccactgatcgcggcggtgatcggcttcgtgctgttgttcgtggtg
cagaacgtctttggccaggaggtcttcctcccccacgaccctggactgacgccatcggcg
atcgagtccagcagtggtgccgccttgctccctgtggcaggaatgacttcgggcctcacg
ccgccctga

DBGET integrated database retrieval system