KEGG   Cupriavidus gilardii: CR3_0183Help
Entry
CR3_0183          CDS       T04050                                 

Gene name
slcC
Definition
(GenBank) 3-phosphoglycerate dehydrogenase
  KO
K16843  (S)-sulfolactate dehydrogenase [EC:1.1.1.310]
Organism
cgd  Cupriavidus gilardii
Pathway
cgd00270  Cysteine and methionine metabolism
cgd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CR3_0183 (slcC)
Enzymes [BR:cgd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.310  (S)-sulfolactate dehydrogenase
     CR3_0183 (slcC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 XdhC_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ALD89442
UniProt: A0A0M4KRX8
Position
1:231710..232648
Genome map
AA seq 312 aa AA seqDB search
MKRICISEFMDPEAVAALTPGFELRYEPDWVDRRAELLAALPAADALIVRNRTQVDVALL
DAAPRLRVVGRLGVGLDNIDVESCRARGIRVIPATGANARSVAEYVVTTAAMLLRGGYQS
SGEVMQGKWPRARLSEGREALGKTLGLIGFGDIGRQTAALAQAFGMRVVAHDPMLRDDDP
VWQRSGVAPRGLDALLAEADAVSLHVPLVPATRHLLDARRLAAMRPGAVLINTARGGVVD
EAALAEALRDGHLAGAALDVFEREPLPAGSPLDGVPNLVLTPHIGGVTREANARVSMLIA
QQVRQALEEAST
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggatctgcatcagcgagttcatggacccggaggcggtggccgcgctgacgccc
gggttcgaactgcgctacgaacccgactgggtcgatcggcgcgccgagctgctggccgcg
ctgcctgcggccgatgcgctgatcgtgcgcaaccgcacgcaggtcgatgtggcgctgctc
gacgccgcgccgcggctgcgcgtggtcgggcggctcggcgtgggcctggacaacatcgac
gtcgaatcgtgcagggcgcgcggcatccgcgtgatcccggccaccggcgccaatgcgcgc
tcggtcgccgagtacgtcgtcaccacggcggcaatgctgctgcgcggcggctatcagagc
agcggcgaggtgatgcagggcaagtggccgcgcgcgcggctgtcggaggggcgcgaggcg
ctgggcaagacgctgggcctgatcggcttcggcgatatcggccggcagaccgcggcgctg
gcgcaggccttcggcatgcgcgtggttgcgcatgatccgatgttgcgcgacgacgatccg
gtctggcaacgcagcggcgtcgcgccgcgcggcctcgatgcgctgctcgccgaagctgac
gcggtcagcctgcacgtgccgctggtgccggcgacccggcatctgctcgacgcgcgacgg
ctcgcggcaatgcggccgggggcggtattgatcaataccgcccgcggcggcgtggtcgac
gaggccgcgctggccgaggcgctgcgcgacgggcatctggccggcgccgcgctcgacgtg
ttcgagcgcgagccgctgccggcgggctcgccgctggacggcgtgcccaatctggtgctg
acgccgcatatcggcggcgtcacgcgcgaagccaatgcgcgcgtgtcgatgctgatcgcg
cagcaggtgcggcaggcgctggaggaggcatcgacatga

DBGET integrated database retrieval system