KEGG   Cupriavidus gilardii: CR3_1126Help
Entry
CR3_1126          CDS       T04050                                 

Gene name
glcB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cgd  Cupriavidus gilardii
Pathway
cgd00620  Pyruvate metabolism
cgd00630  Glyoxylate and dicarboxylate metabolism
cgd01100  Metabolic pathways
cgd01110  Biosynthesis of secondary metabolites
cgd01120  Microbial metabolism in diverse environments
cgd01200  Carbon metabolism
Module
cgd_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CR3_1126 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    CR3_1126 (glcB)
Enzymes [BR:cgd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CR3_1126 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ALD90367
UniProt: A0A0M4KTM1
Position
1:1326710..1328296
Genome map
AA seq 528 aa AA seqDB search
MAITLPAGMKITGEILPAYEDILTPEALALVDKLHRAFEPRRQQLLAARVERAKRLDAGE
RPDFLPETRSIREGDWKIAPIPKALECRRVEITGPVEAKMVINAFNSGADSYMTDFEDSN
TPNWHNQLQGQVNLKAAVRRTLTLEAKGKVYKLNDKIATLQVRPRGWHLDEKHVTIDGQR
VSGGIWDFALFLFHNAKEQIARGAGPFFYLPKMESHLEARLWNDIFVMAQNEIGLPQGTI
KATVLIETILAAFEMEEILYELREHSAGLNAGRWDYIFSCIKKFKTDKNFCLADRAKVTM
TAPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDPEKNEIAMQGIIGDKRRDATDGYD
GGWVAHPGLVEPAMKEFVAVLGDKPNQFDKQRPDVNVSGADLLNFQPETPITEGGLRMNI
NVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLEDGRKVTAEMVRA
LIPEELAKVKEVVGGDTKTYDRAAEIFEQMSTSESFAEFLTLPLYEEI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggccatcacgttgcctgcgggcatgaagattaccggcgaaatcctgccggcctacgaa
gatatcctcacgccggaagcgctggccctggtggacaagctgcaccgtgccttcgagccg
cgccgccagcagctgctggccgcgcgcgtcgaacgcgccaagcgcctggacgcgggcgag
cgccccgacttcctgccggagaccaggtcgatccgcgaaggcgactggaagatcgcgccg
atcccgaaggcgctcgaatgccgccgcgtcgaaatcaccggcccggtcgaagccaagatg
gtcatcaacgcgttcaactcgggcgcggacagctacatgaccgacttcgaggattcgaac
acgccgaactggcacaaccagctgcagggccaggtcaacctgaaggccgccgtgcgccgc
acgctgacgctcgaggccaagggcaaggtctacaagctgaacgacaagatcgccacgctg
caggtgcgtccgcgcggctggcatctggacgagaagcacgtgaccatcgacggccagcgc
gtgtcgggcggcatctgggacttcgcgctgttcctgttccataacgccaaggagcagatc
gcgcgcggcgccggtccgttcttctatctgccgaagatggaaagccatctggaagcgcgc
ctgtggaacgacatcttcgtgatggcgcagaacgagatcggcctgccgcagggcaccatc
aaggcgaccgtgctgatcgagacgatcctggccgccttcgagatggaagagatcctgtac
gagctgcgcgagcacagcgcgggcctgaacgccggccgctgggactacatcttctcgtgc
atcaagaagttcaagaccgacaagaacttctgcctggccgaccgcgccaaggtcacgatg
accgcgccgttcatgcgcgcctacgcgctgctgctgctcaagacctgccacaagcgcggc
gcgcccgcgatcggcggcatgagcgcgctgatcccgatcaagaacgatccggagaagaac
gagatcgcgatgcagggcatcatcggcgacaagcgccgcgatgcgaccgacggctatgac
ggcggctgggtggctcacccgggcctggtcgagccggcgatgaaggaattcgtcgcggtg
ctgggcgacaagccgaaccagttcgacaagcagcgcccggatgtcaacgtcagcggcgcc
gacctgctgaacttccagccggagacgccgatcaccgaaggcggcctgcgcatgaacatc
aatgtgggcatccattacctgggcgcctggctggccggcaacggctgcgtgccgatccac
aacctgatggaagacgccgccaccgccgagatctcgcgttcgcaggtctggcagtggatc
cgctcgccgaagggcgtgctggaggacggccgcaaggtgaccgccgagatggtgcgcgcg
ctgattccggaagaactggccaaggtcaaggaagtggtcggtggcgacacgaagacctac
gaccgcgccgccgagatcttcgaacagatgtcgacgtcggaatcgttcgccgaattcctg
acgctgccgctgtacgaggagatctga

DBGET integrated database retrieval system