KEGG   Cupriavidus gilardii: CR3_1570Help
Entry
CR3_1570          CDS       T04050                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgd  Cupriavidus gilardii
Pathway
cgd00071  Fatty acid degradation
cgd00072  Synthesis and degradation of ketone bodies
cgd00280  Valine, leucine and isoleucine degradation
cgd00310  Lysine degradation
cgd00362  Benzoate degradation
cgd00380  Tryptophan metabolism
cgd00620  Pyruvate metabolism
cgd00630  Glyoxylate and dicarboxylate metabolism
cgd00640  Propanoate metabolism
cgd00650  Butanoate metabolism
cgd00900  Terpenoid backbone biosynthesis
cgd01100  Metabolic pathways
cgd01110  Biosynthesis of secondary metabolites
cgd01120  Microbial metabolism in diverse environments
cgd01130  Biosynthesis of antibiotics
cgd01200  Carbon metabolism
cgd01212  Fatty acid metabolism
cgd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CR3_1570 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    CR3_1570 (atoB)
   00640 Propanoate metabolism
    CR3_1570 (atoB)
   00650 Butanoate metabolism
    CR3_1570 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CR3_1570 (atoB)
   00072 Synthesis and degradation of ketone bodies
    CR3_1570 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CR3_1570 (atoB)
   00310 Lysine degradation
    CR3_1570 (atoB)
   00380 Tryptophan metabolism
    CR3_1570 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CR3_1570 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CR3_1570 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CR3_1570 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgd04147]
    CR3_1570 (atoB)
Enzymes [BR:cgd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CR3_1570 (atoB)
Exosome [BR:cgd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CR3_1570 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III CMD
Motif
Other DBs
NCBI-ProteinID: ALD90799
UniProt: A0A0M4KK86
Position
1:complement(1898625..1899791)
Genome map
AA seq 388 aa AA seqDB search
MIVSAARTAVGKFGGSLAKVPAPELGAIVIQAALERAGVKPEQVSEVIMGQVLTAGSGQN
PARQAAIKAGLPHMVPAMTINKVCGSGLKAVMLAANAIASGDAEIVVAGGQENMSAAPHV
LPGSRDGFRMGDAKLIDTMIVDGLWDVYNQYHMGITAENVAKEYGISREAQDEFAVSSQN
NAEAAQKAGRFDEEIVPVMIPQRKGEPVAFATDEFVRHGATLESIAGLKPAFDKAGTVTA
ANASGINDGAAAVVVMSAAKARELGLTPLATIRAFANAGVDPKVMGMGPVPASQRCLSRA
GWSVQDLDLMEINEAFAAQALAVHKQMGWDTDKVNVNGGAIAIGHPIGASGCRILVTLLH
EMKRRDAKKGLASLCIGGGMGVALAVER
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtatcggccgcgcgcaccgcggtaggcaaattcggcggctcgctggccaaggtg
ccggcccccgagctgggcgccatcgtcatccaggccgcgctcgagcgcgccggcgtcaag
ccggagcaggtcagcgaagtgatcatgggccaggtgctgaccgccggctcgggacagaac
ccggcgcgccaggcggcgatcaaggccggactgccgcatatggtcccggcgatgacgatc
aacaaggtgtgcggttcgggcctgaaggccgtgatgctggccgccaacgcgatcgcctcc
ggcgatgccgagatcgtcgtggccggcggccaggagaacatgagcgcggcgccgcacgtg
ctgccgggctcgcgcgacggcttccgcatgggcgacgccaagctgatcgacacgatgatc
gtcgacggcctgtgggacgtctacaaccagtaccacatgggcatcaccgccgagaacgtg
gccaaggaatacggcatctcgcgcgaggcgcaggacgagttcgcggtcagctcgcagaac
aatgccgaggccgcgcagaaggccgggcgtttcgacgaggaaatcgttccggtgatgatc
ccgcagcgcaagggcgaaccggtggcgttcgccaccgacgagttcgttcgccacggcgcg
acgctcgagagcatcgccggcctgaagccggccttcgacaaggcgggcaccgtgaccgcg
gccaatgcctcgggcatcaacgatggcgccgccgccgtggtggtgatgtcggccgccaag
gcgcgcgagctgggcctgaccccgcttgccacgatccgcgcctttgccaacgccggcgtc
gacccgaaggtcatgggcatgggcccggtgccggcctcgcagcgctgcctgtcgcgcgcc
ggctggagcgtgcaggacctggacctgatggagatcaacgaggcgttcgccgcgcaggcg
ctggcggtgcacaagcagatgggctgggacaccgacaaggtcaacgtcaatggcggcgcg
atcgcgatcggccatccgatcggcgcgtcgggctgccgcattctggtgacgctgctgcac
gaaatgaagcggcgcgatgcgaagaagggcctggcgtcgctgtgcatcggcggcggcatg
ggggtggcgctcgccgtggaacggtga

DBGET integrated database retrieval system