KEGG   Cupriavidus gilardii: CR3_2558Help
Entry
CR3_2558          CDS       T04050                                 

Gene name
cutA
Definition
(GenBank) divalent cation tolerance protein
  KO
K03926  periplasmic divalent cation tolerance protein
Organism
cgd  Cupriavidus gilardii
Brite
KEGG Orthology (KO) [BR:cgd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CR3_2558 (cutA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CutA1
Motif
Other DBs
NCBI-ProteinID: ALD91759
UniProt: A0A0M5KVK3
Position
1:complement(3111786..3112154)
Genome map
AA seq 122 aa AA seqDB search
MDASQVLVVITTLPDEDSATALTRALLEARVAACVNRMPACESQYWWQGKIETARELPLL
IKTTRACYDALEAAIRQHHPYDVPEIVALPVQAGLPAYLDWVVQQTATPGGNGNARRGND
AA
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggacgcatcgcaggtactggtcgtgatcaccacgctgccggacgaggacagcgcaacc
gcgctgacccgcgcgctgctggaagcgcgggtcgctgcgtgcgtgaaccgtatgccggcc
tgcgagtcgcagtactggtggcaggggaagatcgagaccgcgcgcgaactgccgctgctg
atcaagaccacgcgggcttgctacgacgcgctcgaagcggcgatccgccagcaccatccc
tacgacgtgcccgagatcgtcgcgctgcccgtgcaggcggggctgccggcctatctcgac
tgggtcgtccagcagaccgcgacgccgggcggcaacggcaacgcgcgccggggcaacgac
gcggcataa

DBGET integrated database retrieval system