KEGG   Cricetulus griseus (Chinese hamster): 100689033Help
Entry
100689033         CDS       T02813                                 

Gene name
Cyp2a14
Definition
(RefSeq) Cytochrome P-450 2A14
  KO
K07411  cytochrome P450 family 2 subfamily A [EC:1.14.14.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00830  Retinol metabolism
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100689033 (Cyp2a14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cge00199]
    100689033 (Cyp2a14)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100689033 (Cyp2a14)
Cytochrome P450 [BR:cge00199]
 Cytochrome P450, animal type
  CYP2 family
   100689033 (Cyp2a14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 MMS19_N
Motif
Other DBs
NCBI-GeneID: 100689033
NCBI-ProteinID: NP_001230950
UniProt: Q9Z1H8
AA seq 494 aa AA seqDB search
MLASGLLLVSVLAFLVILVLMSVWKQRKLSGKMPPGPTPLPFIGNYLQLNTAQMYNSLMK
ISKRYGPVFTVHLGPRRRIVVLWGQEAVKEALVDQAEEFSGRGEQATFDSFFEGYGLVFS
SGERAKQLRRFSIATLRDFGMGKRGVEERILEEAGYLLEALQKTNGALIDPTFYLSRAVS
NVMSSIVFGDRFDYEDQEFLSLLRMMLETFQFTASSTGQLYEMFSSVMKRLPGPQQQAYK
GLKALEDFIAKKVEQHQSTLDPNSPRDFIDSFLIRMQEEKDPNTEFFMKNLVLTTLNLFA
AGTETISTTLRYGFLLLMKHPDVEAKVHEEIDRVIGRNRQPKYEDRTKMPYTEAVIHEIQ
RFGDVIPMGVPRRVTKDTKFRDFLIPKGTDVFPVLGSVLKDSKFFSNPKDFNPKHFLDGN
MQFKKNDAFVPFSLGKRYCFGEGLARMELFLFLTIILQNFRFRSSQAPQDIDVSPQLVGF
GTLPPNYTMSFLSR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctccggactgctcctggtttctgtgctggccttcctcgtcatcctggtcttg
atgtctgtctggaagcagaggaagctctcagggaagatgcctccgggacccaccccattg
cccttcatcgggaactacctccagctgaacacagcgcagatgtacaactccctcatgaag
atcagcaaacgctatggtcctgtgttcaccgtccacctggggcctcgccgcagaattgtg
gtactatggggacaggaagctgtcaaggaggctctggtggatcaagctgaggaattcagt
gggcgtggcgagcaggccacctttgacagtttcttcgaaggctacggactggtcttcagc
agtggagagagggccaaacagctgcggcgcttctccatcgccacactgcgggactttggc
atgggcaagcgtggtgtcgaggagcgcatcctagaggaagcgggctatctcctggaggct
ttacagaagacaaacggtgctctcattgaccccaccttctacctgagcagagcagtctcc
aacgtcatgagctccatcgttttcggcgaccgctttgactatgaggaccaagagttcctg
tcactgctgaggatgatgctggaaactttccagttcacagcttcatccactgggcagctc
tacgagatgttctcttcagtgatgaagcgcctgccagggccccagcaacaagcctataag
ggactaaaggcactggaagacttcatagccaagaaggtggaacagcatcagagcaccctg
gatcccaattccccaagggacttcattgactccttcctcatccgcatgcaggaggagaag
gaccccaatacagaattcttcatgaaaaatttggtgttgactacactgaacctcttcgct
gctggcacagagaccatcagcacaaccttacgctatggctttctcttgctcatgaagcac
ccagatgtggaggccaaagtccatgaggagatcgaccgggtgattggcaggaaccgacag
cccaaatatgaggaccgaacgaagatgccttacacagaggctgtgatccatgagattcag
agatttggagatgtaatacccatgggcgtgcctcgaagggtcaccaaggacaccaagttc
cgggacttccttattcccaagggcactgacgtgtttcctgtgctgggctctgtgctgaag
gactccaagtttttctccaaccccaaagacttcaatccaaagcacttcctagatggcaat
atgcagtttaagaagaatgatgcctttgtacccttttccttaggaaaacggtactgcttt
ggagaaggactggctagaatggagctctttctcttcctcacaatcatcctgcagaacttt
cgcttcagatcctcacaggcaccccaagacatcgatgtgtcccctcaactggtgggattt
ggaacactcccaccaaactataccatgagtttcttgtcccgttga

DBGET integrated database retrieval system