KEGG   Cricetulus griseus (Chinese hamster): 100689090Help
Entry
100689090         CDS       T02813                                 

Gene name
Neu3
Definition
(RefSeq) sialidase-3
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00511  Other glycan degradation
cge00600  Sphingolipid metabolism
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100689090 (Neu3)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100689090 (Neu3)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     100689090 (Neu3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 100689090
NCBI-ProteinID: NP_001231029
UniProt: B8Y441
AA seq 417 aa AA seqDB search
MEEVSACSLNSTLFQQEHQKGTTYRIPALLYIPPSHTFLAFAEKRSSSKDVDALHLVLRR
GVMKGHSVEWGPLQPLMEATLPGHRTMNPCPVWEQSTSRVLLFFICVPDRVTEHWQIRSG
KNAARLCFLCSQDAGCSWGEVKDLTEEVIGSELKHWATFAVGPGHGIRLQSGRLIIPTYA
YYFSCRFLCFPCSVKPHSLMIYSDDLGVTWHHGKLIGPQVTGECQVAEVTGTSGNLVLYC
NARTPNRFRAESFSTDYGDCFQKPTLNTQLCEPRYGCQGSIVSFQPLKMPFSQDPIGKAA
PTTQKSPLLDSFLEREEGVGRPSGTWLLYSHPTSKKRRINLGIYYNRNPLEVTCWSRPWI
LHCGPCGYSDLAVVEEQGLFACLFECGQEHECEQIAFRLFSVQEVLSCEDCTGPSRD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagtatcagcctgctccctcaacagcactctgttccagcaggaacaccagaaa
gggaccacctaccggattccagcgctgctctacatccctcccagccacaccttcctggcc
tttgcagagaagcgttcctcaagcaaagacgtagatgctctccacctggtgctcaggcga
ggggtgatgaagggccactctgtagagtggggacccctgcagccactgatggaagccaca
ttgcctgggcatcggaccatgaacccctgccctgtatgggagcagagtaccagccgtgtg
ttactgtttttcatctgtgtgccagaccgtgttactgaacattggcagattaggtcaggc
aagaatgccgcccgtctctgcttcctgtgcagtcaggatgctgggtgctcatggggtgaa
gtgaaggacttgactgaggaggtcattggctcagagttgaagcactgggccacatttgct
gtgggcccaggccatggcatccggctgcagtcaggaaggctgatcattcccacctacgcc
tactatttctcatgcaggttcctctgcttcccgtgttcagtcaagccccattccctgatg
atctacagtgatgacttaggagtcacatggcaccatggcaagctcattgggccccaggtg
acaggggagtgccaagtggcagaagtgactgggacgtctggtaaccttgtgctctactgc
aatgcccggacaccaaacagattccgagcagaatcttttagtactgattacggtgactgt
tttcagaaaccaaccctgaacacacaactctgtgagccccgctatggctgccaaggcagt
atagtgagcttccagcccttgaagatgccattctcacaagacccaattggtaaagctgct
cccactactcagaagagccctctgctggacagttttctggagcgggaggaaggagttgga
agaccatcaggaacatggctcttgtactcacatccaactagcaagaagcggagaattaac
ctgggcatctactacaaccggaaccccttggaggtgacctgctggtcccgcccttggatc
ttgcactgtgggccctgtggctactctgatctggctgttgtggaagagcagggcttattt
gcatgtttgtttgaatgtgggcaggagcatgagtgtgagcagattgccttccgtctattt
tcagtccaagaggttttgagctgtgaagactgcactggccctagtagggactaa

DBGET integrated database retrieval system